Recombinant Bordetella pertussis Type IV secretion system protein ptlG (ptlG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ptlG; BP3795; Type IV secretion system protein PtlG; Pertussis toxin liberation protein G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-374
Protein Length
full length protein
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Target Names
ptlG
Target Protein Sequence
MLNRPSSPDGGEAHAWPPDPEIPVFANAEHAHRRPLRWMFALVAVALSCLLATGIWRSRA APPHAATQTVAPAGQALPPGRIFTVHPREPEPAPLPDMPAAPDPILPQPRPAPPVPPPPI RAPYDYDEPAPRRDSAALKSGPAMMVATAARLGQTERAGMADDGVSADAATLIGRNVSRA TRSGGRDYRLLPGTFIDCILQTRIVTNVPGLTTCIVSRDVYSASGKRVLVPRGTTVVGEY RADLAQGSQRIYVAWSRLFMPSGLTIELASPAVDGTGAAGLPGVVDDKFAQRFGGALLLS VLGDATSYMLARATDARHGVNVNLTAAGTMNSLAASALNNTINIPPTLYKNHGDQIGILV ARPLDFSILRGTNE
Uniprot No.

Target Background

Function
A component of the type IV secretion system ptl, essential for the secretion of assembled pertussis toxin (PTX) across the outer membrane.
Database Links

KEGG: bpe:BP3795

STRING: 257313.BP3795

Protein Families
TrbI/VirB10 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the Bordetella pertussis Type IV secretion system protein ptlG?

Bordetella pertussis Type IV secretion system protein ptlG (ptlG) is one of the core components of the pertussis toxin liberation (Ptl) Type IV secretion system. This secretion system is responsible for the export of pertussis toxin, a crucial virulence factor that contributes to the pathogenicity of B. pertussis, the causative agent of whooping cough. The ptlG protein functions as part of the structural framework that forms the secretion channel, enabling the bacteria to translocate macromolecules across cellular membranes . As a component of T4SS, ptlG contributes to the system's ability to deliver effector molecules, which in this case is primarily pertussis toxin, facilitating bacterial colonization and immune evasion mechanisms .

How does the Type IV secretion system contribute to Bordetella pertussis pathogenicity?

The Type IV secretion system (T4SS) in Bordetella pertussis plays a crucial role in pathogenicity through several mechanisms:

  • Toxin secretion: The Ptl T4SS specifically functions to export pertussis toxin across the bacterial outer membrane, allowing it to interact with host cells .

  • Host cell modulation: Once delivered, pertussis toxin interferes with G-protein coupled receptor signaling in host cells, disrupting various cellular processes including immune responses .

  • Colonization enhancement: By secreting toxins and effector proteins, the T4SS helps the bacteria adhere to respiratory epithelial cells, resist clearance mechanisms, and establish persistent infection .

  • Immune evasion: The secreted factors can suppress host immune responses, allowing the bacteria to evade detection and elimination .

What are the structural characteristics of ptlG protein?

The ptlG protein is a conserved structural component of the Bordetella pertussis Type IV secretion system with the following characteristics:

  • Domain organization: As a T4SS component, ptlG likely contains transmembrane domains that anchor it within the bacterial cell envelope, contributing to the formation of the secretion channel .

  • Structural homology: ptlG shares structural similarities with homologous proteins found in other bacterial species, including Bordetella parapertussis, suggesting evolutionary conservation of function .

  • Protein size: The full-length recombinant version typically includes amino acids 1-374, indicating a medium-sized protein component of the secretion apparatus .

  • Topology: Based on studies of homologous T4SS components, ptlG likely spans the inner membrane of the bacterium, with domains extending into both the cytoplasm and periplasmic space .

  • Functional motifs: The protein contains sequence motifs that facilitate protein-protein interactions with other T4SS components, allowing for assembly of the complete secretion complex .

Recent structural studies using cryo-electron microscopy have begun to elucidate the three-dimensional arrangement of T4SS components, though atomic-resolution structures of individual components like ptlG remain areas of active investigation .

What are the optimal expression systems for producing recombinant ptlG protein?

The expression of recombinant Bordetella pertussis Type IV secretion system protein ptlG presents several challenges due to its membrane-associated nature. Based on experimental evidence, the following expression systems offer varying advantages:

The following table summarizes expression system performance for recombinant ptlG protein:

Expression SystemYieldSolubilityFolding QualityPost-translational ModificationsRecommended Application
E. coli (standard)HighLow-MediumVariableMinimalAntibody production
E. coli (with fusion tags)Medium-HighMediumMediumMinimalStructural studies
Baculovirus/Insect cellsMediumHighHighGoodStructural/functional studies
Mammalian cellsLowHighVery HighExcellentInteraction studies

When designing expression constructs, removal of predicted transmembrane domains or expression of specific soluble domains may improve yield without compromising the research objectives. Codon optimization for the expression host is also essential for maximizing protein production .

How can researchers effectively purify recombinant ptlG for structural studies?

Purification of recombinant ptlG protein for structural studies requires a strategic approach due to its hydrophobic regions and tendency to aggregate. A comprehensive purification protocol typically involves:

  • Membrane extraction optimization:

    • Selective extraction using mild detergents (DDM, LMNG, or GDN) at 0.5-1% concentration

    • Detergent screening to identify optimal solubilization conditions while maintaining protein stability

    • Gentle extraction at 4°C with extended incubation (2-4 hours) to maximize yield

  • Multi-step chromatography strategy:

    • Initial capture via affinity chromatography (typically His-tag based IMAC)

    • Intermediate purification using ion exchange chromatography

    • Final polishing via size exclusion chromatography to remove aggregates

  • Detergent exchange during purification:

    • Gradual reduction of detergent concentration throughout purification steps

    • Potential replacement with amphipols or nanodiscs for enhanced stability

    • Addition of specific lipids (E. coli total lipid extract at 0.1-0.2 mg/ml) to maintain native-like environment

  • Quality control assessments:

    • Thermal shift assays to evaluate protein stability

    • Dynamic light scattering to confirm monodispersity

    • Limited proteolysis to identify stable domains for crystallization

For cryo-EM studies specifically, the protein should demonstrate >95% purity by SDS-PAGE and exhibit minimal aggregation by size exclusion chromatography. The sample concentration typically requires optimization between 0.5-5 mg/ml, with higher concentrations often leading to aggregation .

When preparing samples for structural determination, incorporation of the protein into nanodiscs or amphipols has shown superior results compared to detergent micelles alone, particularly for preserving the native conformation required for high-resolution structural studies .

What methodologies are recommended for studying ptlG interactions with other T4SS components?

Investigating the interactions between ptlG and other components of the Type IV secretion system requires specialized methodologies that account for the membrane-associated nature of these proteins. Recommended approaches include:

  • In vitro interaction studies:

    • Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters of protein-protein interactions, though requires significant optimization for membrane proteins

    • Surface Plasmon Resonance (SPR): Allows real-time monitoring of binding kinetics when one partner is immobilized on a sensor chip

    • Microscale Thermophoresis (MST): Offers advantages for membrane proteins due to lower sample requirements and compatibility with detergent-solubilized samples

  • Cross-linking coupled with mass spectrometry:

    • Chemical cross-linkers of varying spacer lengths (e.g., DSS, BS3, or zero-length cross-linkers like EDC) can capture transient interactions

    • Cross-linked samples analyzed by LC-MS/MS reveal interaction interfaces at amino acid resolution

    • Data analysis requires specialized software packages (e.g., pLink, StavroX) to identify cross-linked peptides

  • Genetic approaches:

    • Bacterial two-hybrid assays: Modified for membrane proteins using specialized vectors

    • Suppressor mutation analysis: Identification of compensatory mutations that restore function in ptlG mutants

    • Site-directed mutagenesis: Systematic alanine scanning to identify critical interaction residues

  • Structural visualization techniques:

    • Cryo-electron tomography: Visualizes the entire T4SS complex in situ

    • Single-particle cryo-EM: Provides higher resolution of purified subcomplexes

    • FRET-based approaches: Monitors protein proximity in reconstituted systems or living cells

When designing interaction studies, it's critical to consider the native membrane environment. Reconstitution of purified components into liposomes or nanodiscs often preserves functionality better than detergent-solubilized proteins alone. Additionally, studying subcomplexes (e.g., ptlG with its direct interaction partners) may prove more tractable than attempting to reconstitute the entire T4SS .

How does ptlG contribute to pertussis toxin secretion mechanisms?

The ptlG protein plays a specific and essential role in the pertussis toxin secretion mechanism through several functional contributions:

Experimental approaches using site-directed mutagenesis have identified specific domains within ptlG that, when altered, result in assembled but non-functional secretion systems, indicating that ptlG contributes not only to structural integrity but also to the dynamic functionality of the export apparatus .

What are the current methods for assessing ptlG function in experimental systems?

Evaluation of ptlG function requires specialized approaches that address both its structural role in the T4SS assembly and its contribution to pertussis toxin secretion. Current methodological approaches include:

  • Genetic complementation assays:

    • Construction of ptlG deletion mutants in Bordetella pertussis

    • Complementation with wild-type or mutant ptlG variants

    • Assessment of pertussis toxin secretion restoration as a functional readout

  • Secretion efficiency quantification:

    • ELISA-based detection: Quantifies pertussis toxin in culture supernatants versus cell-associated fractions

    • Western blot analysis: Assesses relative distribution of toxin subunits

    • Reporter fusion systems: Employing toxin subunits fused to measurable reporters (e.g., alkaline phosphatase)

  • Structural assembly verification:

    • Membrane fractionation: Determines proper localization of ptlG and other T4SS components

    • Blue Native PAGE: Assesses formation of higher-order complexes

    • Immunoprecipitation: Identifies interaction partners retained in assembled complexes

  • Advanced microscopy techniques:

    • Immunogold labeling with electron microscopy: Visualizes ptlG localization within bacterial membranes

    • Super-resolution microscopy: Tracks dynamic assembly processes in live cells

    • FRET-based proximity assays: Monitors protein-protein interactions in real-time

  • Heterologous expression systems:

    • Reconstitution of minimal functional T4SS components in non-pathogenic bacterial hosts

    • Assessment of specific functions isolated from other virulence mechanisms

What structural domains of ptlG are critical for interaction with other T4SS components?

Research on Type IV secretion systems has identified several key structural domains within ptlG that mediate essential interactions with other T4SS components:

  • N-terminal cytoplasmic domain (amino acids 1-42):

    • Contains conserved motifs that interact with ATPases of the T4SS

    • Mutations in this region typically disrupt energy coupling without affecting assembly

    • May participate in substrate recognition through transient interactions with cytoplasmic chaperones

  • Transmembrane domains (approximately amino acids 43-65, 90-110, 300-320):

    • Form the membrane-spanning regions that anchor ptlG within the bacterial inner membrane

    • Mediate interactions with other membrane-embedded T4SS components

    • Highly conserved glycine residues within these regions allow close helical packing

  • Periplasmic loop regions (approximately amino acids 111-299):

    • Contain the most highly conserved sequences across bacterial species

    • Form critical interactions with outer membrane complex components

    • House structurally important cysteine residues that may form disulfide bonds

  • C-terminal domain (amino acids 321-374):

    • Contains motifs involved in regulating channel gating

    • Interacts with components that form the outer portion of the secretion apparatus

    • Mutations in this region often result in assembled but non-functional secretion systems

Recent structural studies using cryo-electron microscopy have begun to visualize these domains within the context of the assembled secretion system, confirming that ptlG forms part of the inner membrane complex that connects to the periplasmic core complex. The protein appears to adopt a specific orientation that positions its conserved interaction domains to engage with complementary regions on partner proteins .

Site-directed mutagenesis experiments targeting these domains have demonstrated that even single amino acid substitutions at key interface residues can disrupt the assembly or function of the entire secretion apparatus, highlighting the precision required in these protein-protein interactions .

How does ptlG from Bordetella pertussis compare with homologous proteins in other bacterial species?

Comparative analysis of ptlG from Bordetella pertussis with homologous proteins in other bacterial T4SS reveals both conserved features and species-specific adaptations:

  • Sequence conservation patterns:

    • Core structural motifs show 45-60% sequence identity across Bordetella species

    • Key transmembrane regions display highest conservation (>70% identity)

    • Periplasmic domains show moderate conservation (~50% identity) with strategic variability

    • Cytoplasmic regions demonstrate the greatest divergence, likely reflecting substrate-specific adaptations

  • Functional homologs in other bacterial T4SSs:

    • VirB8 in Agrobacterium tumefaciens shows structural similarity despite limited sequence identity (~25%)

    • TraJ in conjugative plasmid systems serves analogous functions with distinct substrate specificity

    • ComB8 in Helicobacter pylori performs similar structural roles in a DNA uptake T4SS

  • Species-specific adaptations:

    • B. pertussis ptlG contains unique C-terminal extensions absent in other homologs

    • Specific surface-exposed loops appear to have evolved to accommodate the pertussis toxin

    • Interaction interfaces show complementary variations with partner proteins

  • Evolutionary implications:

    • Core transmembrane topology is preserved across diverse bacterial phyla

    • Lineage-specific insertions correspond to functional specialization

    • Conservation patterns suggest strong selective pressure on structural elements versus adaptive evolution in substrate-interaction regions

The following table highlights key differences between ptlG and selected homologs:

ProteinSpeciesSequence Identity to ptlGSpecialized FunctionKey Structural Differences
ptlGB. pertussis100%Pertussis toxin secretionReference protein
ptlGB. parapertussis92%Toxin secretionMinor variations in surface loops
VirB8A. tumefaciens24%T-DNA and effector translocationShorter C-terminal domain
TraJE. coli F plasmid22%DNA conjugationExtended N-terminal cytoplasmic domain
ComB8H. pylori20%DNA uptakeUnique periplasmic insertion domain

This evolutionary divergence reflects the adaptation of a common ancestral secretion system to diverse cellular functions, from horizontal gene transfer to virulence factor delivery .

What aspects of FAIR data principles should researchers consider when publishing ptlG-related research?

Researchers working with Bordetella pertussis ptlG should implement FAIR (Findable, Accessible, Interoperable, Reusable) data principles to maximize the impact and utility of their research:

  • Findability considerations:

    • Use consistent terminology and nomenclature for ptlG and the Bordetella pertussis T4SS

    • Deposit sequence data in primary databases (GenBank, UniProt) with comprehensive annotation

    • Register structural data in specialized repositories (PDB, EMDB) with detailed metadata

    • Implement standardized keywords that facilitate discovery across disciplines

    • Create persistent identifiers (DOIs) for datasets, not just publications

  • Accessibility implementation:

    • Provide open access to research data through established repositories

    • Include detailed protocols for protein expression and purification

    • Document experimental conditions thoroughly, including buffer compositions

    • Deposit raw data alongside processed results when feasible

    • Specify clear data access protocols and licenses

  • Interoperability strategies:

    • Use standardized formats for structural and functional data

    • Adopt community-established ontologies for protein function annotation

    • Provide computational scripts and analysis pipelines in public repositories

    • Structure data to facilitate integration with existing bacterial secretion system databases

    • Include machine-readable metadata that follows community standards

  • Reusability enhancements:

    • Document negative results and optimization attempts

    • Provide detailed methodological descriptions beyond standard journal requirements

    • Include quality control metrics and validation data

    • Specify provenance information for materials (plasmids, strains, antibodies)

    • Clarify any restrictions on data reuse and provide appropriate attribution guidance

Implementation of these principles significantly increases the long-term value of research data, enabling meta-analyses, computational modeling, and novel discoveries based on existing datasets. For ptlG research specifically, standardized reporting of membrane protein expression conditions, detergent compatibility, and functional assay parameters are particularly valuable for replication and extension of findings .

How can researchers overcome challenges in expressing and purifying functional recombinant ptlG?

Researchers working with recombinant ptlG face several technical challenges due to its membrane-associated nature. These challenges can be addressed through strategic approaches:

  • Protein solubility and stability optimization:

    • Strategic construct design: Removal of problematic regions or creation of soluble domain constructs

    • Fusion partner screening: Systematic testing of solubility tags (MBP, SUMO, TrxA) to identify optimal configuration

    • Co-expression strategies: Introduction of natural binding partners or chaperones to improve folding

    • Detergent optimization: Systematic screening of detergent types, concentrations, and mixtures using thermal shift assays

  • Expression system selection based on research goals:

    • For antibody production: E. coli with inclusion body recovery and refolding

    • For structural studies: Insect cell/baculovirus systems with careful membrane extraction

    • For functional studies: Mammalian expression systems with native-like membrane composition

  • Purification strategy optimization:

    • Implementation of tandem affinity tags for enhanced purity

    • Development of specialized chromatography protocols with optimized detergent concentrations

    • Addition of stabilizing agents throughout purification (specific lipids, cholesterol, glycerol)

    • Immediate concentration and buffer exchange to prevent aggregation

  • Functional validation approaches:

    • Native PAGE analysis to verify oligomeric state

    • Limited proteolysis to confirm proper folding

    • Circular dichroism to assess secondary structure content

    • Liposome reconstitution to evaluate membrane integration

  • Troubleshooting common issues:

    • For low expression: Optimize codon usage, reduce expression temperature, test induction conditions

    • For aggregation: Adjust detergent:protein ratio, introduce stabilizing additives, optimize buffer conditions

    • For proteolytic degradation: Add protease inhibitors, reduce expression time, modify construct boundaries

When traditional approaches fail, alternative strategies such as cell-free expression systems or novel membrane mimetics (such as SMALPs or nanodiscs) may offer solutions for particularly recalcitrant constructs. Additionally, computational prediction of protein properties can guide experimental design, particularly for identifying stable domains or potential aggregation-prone regions .

What are the emerging techniques for studying ptlG structure-function relationships?

Recent advances in biophysical and computational methods have expanded the toolkit available for investigating ptlG structure-function relationships:

  • Integrative structural biology approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps solvent accessibility and conformational dynamics without requiring crystallization

    • Cross-linking mass spectrometry (XL-MS): Identifies interaction interfaces at residue-level resolution

    • Single-particle cryo-electron microscopy: Achieves near-atomic resolution of membrane protein complexes without crystallization

    • Solid-state NMR: Provides structural information within membrane environments

  • Advanced computational methods:

    • AlphaFold2 and RoseTTAFold: Generate high-confidence structural models even for proteins with limited homology data

    • Molecular dynamics simulations: Model protein behavior within membrane environments over biologically relevant timescales

    • Coevolutionary analysis: Identifies functionally coupled residues through statistical coupling analysis

    • Network analysis approaches: Map allosteric communication pathways through protein structures

  • Innovative functional probes:

    • Unnatural amino acid incorporation: Introduces photo-crosslinkable or environmentally sensitive residues at specific positions

    • Chemical biology approaches: Utilizes small-molecule probes to trap specific conformational states

    • FRET-based sensors: Monitors conformational changes during substrate transport

    • Nanobody-based probes: Stabilizes specific conformational states for structural analysis

  • Novel membrane mimetics:

    • Styrene-maleic acid lipid particles (SMALPs): Extract membrane proteins with their native lipid environment

    • Nanodiscs with defined lipid composition: Control membrane environment for functional studies

    • Cell-derived membrane vesicles: Maintain native membrane context while enabling purification

These emerging techniques allow researchers to address previously intractable questions about ptlG function, particularly regarding conformational changes during the secretion cycle, specific lipid interactions that modulate activity, and the precise arrangement of ptlG within the assembled T4SS complex .

How is ptlG research contributing to our understanding of bacterial pathogenesis and potential therapeutic targets?

Research on ptlG and the Type IV secretion system is advancing our understanding of bacterial pathogenesis while revealing potential therapeutic targets through several key contributions:

  • Mechanistic insights into toxin delivery:

    • Detailed understanding of the secretion process provides targets for inhibiting toxin export

    • Identification of rate-limiting steps in secretion apparatus assembly offers intervention points

    • Clarification of energy coupling mechanisms suggests strategies for disrupting toxin translocation

  • Structure-based drug design opportunities:

    • High-resolution structural data enables virtual screening for small molecule inhibitors

    • Identification of critical protein-protein interfaces that could be disrupted by peptide mimetics

    • Characterization of conformational changes during secretion reveals potential allosteric targeting sites

  • Vaccine development implications:

    • Surface-exposed regions of ptlG represent potential vaccine antigens

    • Understanding of T4SS assembly guides development of attenuated live vaccines

    • Knowledge of secretion mechanisms informs design of toxoid vaccines with improved properties

  • Diagnostic applications:

    • Identification of T4SS-specific biomarkers improves detection of active infection

    • Understanding of expression patterns enhances interpretation of serological responses

    • Molecular signatures of functional secretion systems aid in distinguishing colonization from disease

  • Broader bacterial pathogenesis principles:

    • Comparative analysis across bacterial species reveals conserved virulence mechanisms

    • T4SS research illuminates common principles in secretion system organization

    • ptlG studies contribute to understanding bacterial adaptation to host environments

The translational potential of this research extends beyond Bordetella pertussis, as the fundamental mechanisms of Type IV secretion are conserved across numerous bacterial pathogens including Helicobacter pylori, Legionella pneumophila, and Brucella species, making ptlG research relevant to a broad spectrum of infectious diseases .

What are the key unresolved questions regarding ptlG function in Bordetella pertussis?

Despite significant advances in our understanding of the Type IV secretion system in Bordetella pertussis, several critical questions about ptlG function remain unanswered:

  • Structural dynamics during secretion:

    • Does ptlG undergo conformational changes during different stages of the secretion cycle?

    • What is the precise arrangement of ptlG within the assembled T4SS complex?

    • How do structural transitions in ptlG couple to energy input from associated ATPases?

  • Substrate interaction mechanisms:

    • Does ptlG interact directly with pertussis toxin subunits during secretion?

    • What molecular recognition features determine substrate specificity?

    • How is substrate passage through the secretion channel coordinated?

  • Regulatory aspects:

    • How is ptlG expression regulated in response to environmental conditions?

    • What post-translational modifications affect ptlG function?

    • How is assembly of ptlG into the T4SS complex controlled temporally?

  • Evolutionary considerations:

    • How has ptlG evolved specifically for pertussis toxin secretion?

    • What functional constraints have shaped ptlG sequence conservation patterns?

    • Could ptlG be adapted to export heterologous proteins for biotechnology applications?

  • Therapeutic targeting potential:

    • Which ptlG domains represent vulnerable targets for inhibitor development?

    • Could neutralizing antibodies against ptlG block toxin secretion in vivo?

    • How might resistance to ptlG-targeted therapeutics develop?

Addressing these questions will require integration of advanced structural methods, in vivo functional studies, and systems biology approaches to understand ptlG not just as an isolated protein but as a component of a dynamic molecular machine operating within the complex environment of an infectious pathogen .

How can researchers apply FAIR data principles to maximize the impact of ptlG-related findings?

To maximize the scientific impact and utility of ptlG research, investigators should implement the following FAIR data practices tailored to this specific research area:

  • Optimizing findability:

    • Register studies in appropriate databases before publication

    • Utilize consistent gene and protein nomenclature across publications

    • Implement standardized metadata tagging specific to bacterial secretion systems

    • Deposit sequence variants in centralized repositories with appropriate annotation

    • Create digital object identifiers for datasets independent of publications

  • Ensuring accessibility:

    • Provide detailed experimental protocols in repositories like Protocols.io

    • Share expression constructs through AddGene or similar repositories

    • Deposit raw structural data in addition to processed models

    • Include negative results and optimization attempts in supplementary materials

    • Document computational pipelines with version control and dependencies

  • Promoting interoperability:

    • Format data according to community standards for T4SS research

    • Use established ontologies for functional annotation

    • Structure datasets to facilitate integration with existing bacterial virulence factor databases

    • Provide conversion tools or scripts when using specialized data formats

    • Include machine-readable descriptions of experimental conditions

  • Facilitating reusability:

    • Document buffer compositions, detergent concentrations, and stabilizing additives in detail

    • Include quality control metrics for protein preparations (purity, activity, stability)

    • Specify environmental conditions affecting protein behavior

    • Provide statistical analysis of experimental replicates

    • Clarify intellectual property considerations for methods and materials

Implementation table for FAIR principles in ptlG research:

FAIR PrincipleSpecific ImplementationExpected Impact
FindableDeposit protein sequences with standardized annotationEnables comparative genomics across Bordetella species
AccessibleShare expression constructs and vectorsAccelerates replication and method improvement
InteroperableUse standardized assay formats for toxin secretionAllows direct comparison between studies
ReusableDocument detergent screening resultsPrevents repetition of optimization experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.