Recombinant Bordetella pertussis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics and Function

Classification and Catalytic Activity

  • EC Number: 3.6.1.27

  • Alternative Names: Bacitracin resistance protein, undecaprenyl pyrophosphate phosphatase

  • Function: Hydrolyzes undecaprenyl diphosphate to undecaprenyl phosphate (Und-P), a glycan carrier essential for peptidoglycan and lipopolysaccharide biosynthesis . This activity is linked to bacitracin resistance, as bacitracin inhibits Und-PP dephosphorylation .

Notes:

  • E. coli-derived variants are widely used due to cost-effectiveness and scalability .

  • Mammalian cell systems may yield post-translationally modified proteins for specific assays .

Functional Roles and Research Applications

Physiological Relevance

  • Bacitracin Resistance: uppP counteracts bacitracin by dephosphorylating Und-PP, bypassing antibiotic inhibition .

  • Membrane Stress Adaptation: Und-P regeneration supports lipid carrier recycling during envelope assembly, critical under stress conditions .

Research Applications

  • Antibiotic Mechanism Studies: Used to investigate bacitracin resistance pathways .

  • Structural Biology: Recombinant uppP aids in crystallization and enzyme kinetics assays .

Comparative Analysis of Recombinant uppP

Key Differences Across Host Systems

ParameterE. coliMammalian CellsBaculovirus
Post-Translational ModificationsMinimalPotential (e.g., glycosylation)Potential
YieldHighModerateModerate
CostLowHighModerate

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. We recommend contacting your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
uppP; bacA; upk; BP1904; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Target Names
uppP
Target Protein Sequence
MTDSTLHLLKAFFLGIVEGLTEFIPVSSTGHLIVIGDWINFASSSGKVFEVVIQFGSILA VMWIFRARLWQLIRGTLTGVRQEVNFTRNLLLAFLPAAVIGAIFIKSIKQVFYHPGVVAV TLVVGGFIMLWVERRAPHTPGDAPGAADDTASDERASAHTLEQISAKQALGVGVAQCVAM IPGVSRSGATIIGGMIAGIQRKTATEFSFFLAMPTMLGAAVYDLYRNIGLLSQHDMSAIA VGFVAAFLSALVVVRAVLRFVANHTYRVFAWYRIALGLVVAAWIYAK
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: bpe:BP1904

STRING: 257313.BP1904

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its function in Bordetella pertussis?

Undecaprenyl-diphosphatase (uppP) is an essential enzyme in Bordetella pertussis with EC number 3.6.1.27. It functions primarily in cell wall biosynthesis by recycling the lipid carrier undecaprenyl pyrophosphate. The enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which is a critical step in peptidoglycan synthesis. This process is essential for bacterial cell wall integrity and growth. Additionally, uppP is known by alternative names including Bacitracin resistance protein and Undecaprenyl pyrophosphate phosphatase, indicating its role in antibiotic resistance mechanisms.

How is recombinant Bordetella pertussis uppP typically produced for research applications?

Recombinant Bordetella pertussis uppP is typically produced using E. coli expression systems. The process involves cloning the gene sequence from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) into appropriate expression vectors, transforming E. coli host cells, and inducing protein expression under controlled conditions. Following expression, the protein is purified to a high degree (>85% as determined by SDS-PAGE). The recombinant protein may be produced as a partial sequence rather than the full-length protein, depending on research requirements and expression optimization parameters. Expression tags may be added during the manufacturing process to facilitate purification and detection, though the specific tag type is determined during production based on experimental needs.

What are the optimal storage conditions for maintaining recombinant uppP activity?

The optimal storage conditions for recombinant uppP depend on its formulation. For lyophilized preparations, the protein maintains stability for approximately 12 months when stored at -20°C to -80°C. In liquid form, the shelf life is reduced to approximately 6 months at the same temperature range. For working solutions, it's recommended to store aliquots at 4°C for no more than one week, as repeated freeze-thaw cycles significantly reduce enzyme activity and should be avoided. For long-term storage of reconstituted protein, adding glycerol to a final concentration of 5-50% (optimally 50%) and storing in small aliquots at -20°C to -80°C is recommended to preserve enzymatic activity.

What are the key considerations for designing experiments to evaluate uppP enzymatic activity?

When designing experiments to evaluate uppP enzymatic activity, researchers should consider multiple factors:

  • Substrate preparation: Pure undecaprenyl pyrophosphate must be available as substrate

  • Buffer optimization: Activity is pH-dependent, requiring buffer screening

  • Divalent cation requirements: Testing various concentrations of Mg²⁺, Mn²⁺, or Ca²⁺

  • Temperature optimization: Determining optimal reaction temperature

  • Reaction monitoring: Methods to detect phosphate release or substrate depletion

A robust experimental design should include:

  • Appropriate positive and negative controls

  • Time-course measurements to determine initial velocity

  • Validation of linear range for enzyme concentration

  • Assessment of potential inhibitors or activators

For kinetic analyses, researchers should employ multiple substrate concentrations to determine Km and Vmax parameters using Michaelis-Menten or Lineweaver-Burk plots.

How can researchers effectively reconstitute lyophilized recombinant uppP protein for experimental use?

To effectively reconstitute lyophilized recombinant uppP protein:

  • Pre-centrifugation: Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom of the container.

  • Reconstitution solution: Use deionized sterile water to reconstitute the protein to a concentration between 0.1-1.0 mg/mL.

  • Glycerol addition: For long-term stability, add glycerol to a final concentration of 5-50% (with 50% being optimal for maximum stability).

  • Aliquoting: Divide the reconstituted protein into small working aliquots to avoid repeated freeze-thaw cycles.

  • Quality control: Verify protein activity using a standardized enzymatic assay before experimental use.

  • Storage: Store reconstituted aliquots at -20°C to -80°C for optimal stability, with working aliquots kept at 4°C for no more than one week.

This methodological approach ensures maximum retention of enzymatic activity and experimental reproducibility.

What analytical methods are most effective for measuring uppP activity in vitro?

Several analytical methods can effectively measure uppP activity in vitro, each with specific advantages:

MethodPrincipleAdvantagesLimitationsSensitivity
Malachite Green AssayColorimetric detection of released phosphateSimple, high-throughput compatibleIndirect measurement0.1-10 nmol Pi
Radiolabeled SubstrateTracking ³²P-labeled phosphate releaseDirect measurement, high sensitivityRequires radioactive handling0.01-0.1 nmol
HPLC AnalysisSeparation and quantification of substrate/productDirect measurement, no labels neededEquipment intensive0.5-50 nmol
Mass SpectrometryDetection of mass changes in substrate/productHigh specificity, structural informationComplex sample preparation0.05-5 nmol
Coupled Enzyme AssayLinks phosphate release to NADH oxidationContinuous measurement, real-timePotential interference0.2-20 nmol

When selecting a method, researchers should consider their specific experimental goals, available equipment, and required sensitivity levels. For kinetic studies, continuous methods like coupled enzyme assays or HPLC may be preferable, while high-throughput screening might benefit from the simpler malachite green approach.

How does uppP expression change during Bordetella pertussis infection, and what are the implications for pathogenesis?

During Bordetella pertussis infection, uppP expression patterns appear to be dynamically regulated in response to environmental cues within the host. When examining the related species B. bronchiseptica internalized in macrophages, researchers observed significant downregulation of cell wall synthesis genes, including those involved in the undecaprenyl-phosphate pathway. This suggests that uppP expression may be similarly modulated during B. pertussis infection.

The implications for pathogenesis are substantial:

  • Adaptive metabolism: Downregulation of cell wall synthesis genes, potentially including uppP, suggests a metabolic adaptation to the intracellular environment, shifting from active growth to survival mode.

  • Virulence regulation: The suppression of cell division and cell wall synthesis correlates with changes in virulence factor expression, indicating coordinated regulation between structural components and pathogenicity factors.

  • Immune evasion: Modulation of cell surface components through altered uppP activity may contribute to immune evasion strategies.

  • Persistence mechanisms: The downregulation pattern observed in related Bordetella species suggests that reduced cell wall synthesis might contribute to persistence within host cells.

Research indicates that this expression pattern is part of a broader transcriptional response that includes suppression of growth and certain virulence factors while activating stress responses and repair mechanisms.

What approaches can be used to investigate the potential of uppP as an antimicrobial target in Bordetella pertussis?

Investigating uppP as an antimicrobial target requires multi-faceted approaches:

  • Target validation studies:

    • Gene knockout or knockdown experiments to confirm essentiality

    • Conditional expression systems to determine minimum required expression levels

    • In vivo infection models to assess virulence impact

  • High-throughput screening:

    • Development of cell-free enzymatic assays suitable for compound libraries

    • Whole-cell screening with reporter systems linked to cell wall integrity

    • Fragment-based screening for identifying molecular scaffolds

  • Structure-based drug design:

    • X-ray crystallography or cryo-EM structural determination

    • In silico molecular docking of potential inhibitors

    • Structure-activity relationship studies of lead compounds

  • Resistance potential assessment:

    • Directed evolution experiments to identify potential resistance mutations

    • Cross-resistance studies with existing antimicrobials

    • Fitness cost analysis of resistance mutations

  • Experimental design considerations:

    • Control groups must include existing antibiotics targeting cell wall synthesis

    • Between-subjects design for animal efficacy studies

    • Within-subjects design for pharmacokinetic evaluations

This comprehensive approach ensures rigorous evaluation of uppP as a viable antimicrobial target against Bordetella pertussis infections.

How do post-translational modifications affect uppP functionality, and how can these be studied?

Post-translational modifications (PTMs) of uppP can significantly impact its enzymatic function, membrane localization, and regulatory interactions. Although specific PTMs of Bordetella pertussis uppP have not been extensively characterized in the available search results, several approaches can be employed to study potential modifications:

  • Identification of PTMs:

    • Mass spectrometry-based proteomics to identify phosphorylation, methylation, or other modifications

    • Western blot analysis with PTM-specific antibodies

    • 2D gel electrophoresis to detect charge or mass changes

  • Functional impact assessment:

    • Site-directed mutagenesis of potential modification sites

    • Enzyme activity assays comparing native and modified forms

    • Membrane association studies to determine localization effects

  • Regulatory mechanisms:

    • Identification of kinases, phosphatases, or other modifying enzymes

    • Temporal analysis of modifications during different growth phases

    • Stress response conditions that trigger modification changes

  • Experimental design considerations:

    • Control for artifactual modifications during sample preparation

    • Use of phosphatase inhibitors when assessing phosphorylation

    • Careful selection of expression systems that recapitulate native modifications

A comprehensive experimental approach would involve creating a systematic mutational library of potential modification sites and assessing their impact on enzymatic parameters, membrane association, and protein-protein interactions under various physiological conditions.

What are common obstacles in purifying active recombinant uppP, and how can they be addressed?

Purifying active recombinant uppP presents several challenges due to its membrane-associated nature and enzymatic properties. Common obstacles and their solutions include:

ChallengeCauseSolution Strategy
Low expression yieldToxicity to host cellsUse tightly controlled inducible systems; lower induction temperature (16-20°C)
Protein insolubilityHydrophobic membrane domainsAdd appropriate detergents (DDM, CHAPS); use fusion tags (MBP, SUMO)
Loss of activity during purificationDetergent effects on structureScreen multiple detergent types and concentrations
AggregationImproper foldingInclude stabilizing agents (glycerol, specific lipids); optimize buffer composition
Heterogeneous productProteolytic degradationAdd protease inhibitors; use E. coli strains lacking specific proteases
Co-purifying contaminantsNon-specific bindingImplement additional purification steps; optimize imidazole gradient for His-tagged proteins
Variable specific activityIncorrect folding or PTMsStandardize refolding protocols; develop activity-based normalization

Effective purification typically requires optimizing each step of the process specifically for uppP, rather than relying on generic protocols. When expressing in E. coli, maintaining >85% purity by SDS-PAGE is achievable with optimized protocols. For functional studies, it's critical to verify enzymatic activity immediately after purification using standardized assays.

How can researchers address reproducibility challenges when working with recombinant uppP in different experimental systems?

Addressing reproducibility challenges with recombinant uppP requires systematic approaches to standardization and validation:

  • Protein batch consistency:

    • Implement rigorous quality control with activity assays for each preparation

    • Maintain detailed records of expression conditions and purification steps

    • Consider using commercial sources with standardized production methods

  • Storage and handling standardization:

    • Establish uniform aliquoting and storage protocols (-20°C to -80°C)

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Include glycerol (optimally 50%) for long-term stability

  • Experimental design controls:

    • Include internal activity standards in each experiment

    • Employ randomization and blinding where appropriate

    • Follow systematic experimental design principles with appropriate controls

  • Method validation:

    • Cross-validate results using multiple analytical techniques

    • Perform inter-laboratory validation when possible

    • Document all protocol deviations and environmental conditions

  • Data management and reporting:

    • Maintain comprehensive records of all experimental parameters

    • Report protein batch information in publications

    • Follow field-specific reporting guidelines for methods descriptions

Implementing these practices significantly improves reproducibility across different experimental systems and research laboratories, enhancing the reliability of uppP-related research findings.

What are the key considerations for designing inhibitor screening assays for uppP?

Designing effective inhibitor screening assays for uppP requires careful consideration of multiple factors:

  • Assay format selection:

    • High-throughput compatibility for primary screening

    • Secondary confirmation assays with different detection principles

    • Counter-screening to eliminate false positives

  • Enzyme preparation:

    • Consistent activity across batches

    • Stability throughout the screening timeframe

    • Appropriate concentration for signal window optimization

  • Reaction conditions optimization:

    • Buffer composition and pH optimization

    • Substrate concentration (typically at or below Km for inhibitor sensitivity)

    • Incubation time in the linear range of enzyme activity

  • Detection system considerations:

    • Signal-to-background ratio optimization

    • Minimal compound interference with detection method

    • Sensitivity appropriate for the enzyme concentration used

  • Controls and validation:

    • Positive controls (known inhibitors if available)

    • Vehicle controls (DMSO tolerance assessment)

    • Z'-factor determination to ensure assay quality

    • Hit confirmation with dose-response curves

  • Data analysis planning:

    • Statistical methods for hit identification

    • Elimination of systematic errors (edge effects, etc.)

    • Structure-activity relationship analysis for hit compounds

The experimental design should include between-subjects treatment comparisons for different inhibitor classes and concentrations, while employing appropriate randomization to minimize bias. This comprehensive approach ensures the identification of genuine uppP inhibitors while minimizing false positives and negatives.

How does uppP research in Bordetella pertussis contribute to our understanding of bacterial cell wall synthesis across species?

Research on Bordetella pertussis uppP provides valuable insights into the universal and species-specific aspects of bacterial cell wall synthesis:

  • Evolutionary conservation: The uppP gene is part of an ancient genetic pathway for cell wall synthesis, with homologs present across diverse bacterial species. Studying B. pertussis uppP contributes to our understanding of the conserved mechanisms underlying peptidoglycan assembly.

  • Regulatory networks: Expression analysis during infection reveals that uppP regulation is integrated with other cell division genes (ftsZ, ftsA, ftsQ) and cell wall synthesis genes (murC, murG, ftsW, murD), demonstrating coordinated control of cell envelope biogenesis. This correlation provides insight into the regulatory networks governing bacterial cell division and wall synthesis across species.

  • Stress response integration: The downregulation of uppP and related cell wall synthesis genes during macrophage internalization highlights how bacteria modulate cell wall metabolism in response to host environments. This response pattern may be conserved across multiple bacterial pathogens as a survival strategy.

  • Pathogen-specific adaptations: Comparing uppP function and regulation between B. pertussis and other bacteria reveals species-specific adaptations in cell wall synthesis that may correspond to different ecological niches and pathogenic strategies.

  • Antibiotic resistance mechanisms: As uppP is also known as bacitracin resistance protein, research on this enzyme contributes to understanding intrinsic antibiotic resistance mechanisms that protect cell wall synthesis pathways across bacterial species.

This research ultimately enhances our fundamental understanding of bacterial physiology while potentially identifying conserved or species-specific targets for antimicrobial development.

What are the implications of uppP research for vaccine development against Bordetella pertussis?

While uppP itself may not be a direct vaccine antigen candidate, research on this enzyme has several important implications for Bordetella pertussis vaccine development:

  • Understanding cellular physiology: Research on uppP and related cell wall synthesis pathways provides insight into B. pertussis adaptation during infection. This knowledge helps scientists better understand how the bacterium responds to host environments, which can inform rational vaccine design approaches.

  • Antigen expression regulation: The regulatory networks controlling uppP expression appear to be integrated with virulence factor expression. For example, when B. bronchiseptica (closely related to B. pertussis) internalizes in macrophages, both cell wall synthesis genes and several virulence factors show coordinated expression changes. Understanding these regulatory networks can help predict how vaccine antigens might be expressed under different conditions.

  • Cellular stress responses: The data showing downregulation of uppP during host cell internalization indicates activation of specific stress responses. These stress responses may alter the expression of potential vaccine antigens, affecting their recognition by the immune system during natural infection versus vaccination.

  • Novel adjuvant approaches: Components of the cell wall synthesis pathway or their products could potentially serve as adjuvants or delivery systems for vaccine antigens, enhancing immunogenicity.

  • Cell wall modification effects: Changes in uppP activity would affect cell wall composition, potentially altering the presentation of surface antigens targeted by vaccines. This understanding helps in designing vaccines that target antigens with consistent expression and accessibility.

These insights contribute to the complex understanding of B. pertussis physiology that underlies rational vaccine design strategies against pertussis disease.

How can transcriptomic data on uppP expression be integrated with proteomic and metabolomic analyses for systems biology approaches?

Integrating transcriptomic, proteomic, and metabolomic data on uppP requires sophisticated systems biology approaches:

  • Multi-omics data collection and normalization:

    • Coordinate sample collection across platforms to ensure comparability

    • Develop normalization strategies to account for different data scales

    • Implement quality control metrics specific to each data type

  • Correlation analysis across platforms:

    • Examine correlation between uppP transcript levels and protein abundance

    • Relate enzyme levels to substrate/product concentrations in the undecaprenyl phosphate cycle

    • Identify potential post-transcriptional regulatory mechanisms when discrepancies exist

  • Network reconstruction approaches:

    • Place uppP in the context of peptidoglycan synthesis pathways

    • Identify co-regulated genes across transcriptional datasets

    • Map protein-protein interactions from proteomic data

  • Temporal dynamics integration:

    • Track expression changes across infection time courses, as seen in macrophage internalization studies

    • Correlate transcriptional changes with metabolic shifts in cell wall precursors

    • Develop mathematical models that predict pathway flux based on enzyme levels

  • Experimental design considerations:

    • Ensure sufficient biological replicates across all platforms

    • Include appropriate time points to capture dynamic responses

    • Control for batch effects and technical variation

  • Visualization and analysis tools:

    • Pathway enrichment analysis incorporating all data types

    • Interactive visualization tools that overlay multiple data types

    • Machine learning approaches to identify patterns across datasets

This integrated approach provides a comprehensive understanding of uppP's role within the complex network of cell wall synthesis, potentially revealing emergent properties not visible from any single data type alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.