Recombinant Bordetella petrii Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Bpet0123; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Target Names
mscL
Target Protein Sequence
MSKASGFLKEFRDFAVKGNAIDLAVGVIIGAAFGKIVDSVVKDLIMPLVNYILGGSVDFS NKFLVLSAPDGYAGPMTYADLTKAGAIVLAWGNFLTILINFILLALVVFIIVKAINAARR KEEEAPAEPAAPPEDVVVLREIRDLLKK
Uniprot No.

Target Background

Function

This channel opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bordetella petrii and why is it significant for mechanosensitive channel research?

Bordetella petrii is an emerging bacterial pathogen first identified environmentally and subsequently isolated from clinical samples associated with mandibular osteomyelitis, ear bone infections, cystic fibrosis, and chronic pulmonary disease . This bacterium demonstrates remarkable genomic plasticity, undergoing massive genomic rearrangements both in vitro and in vivo . This adaptability makes B. petrii particularly interesting for studying mechanosensitive channels, as these membrane proteins respond to mechanical forces and osmotic changes – conditions that frequently fluctuate during host colonization and infection persistence. The bacteria's demonstrated ability to persist in chronic pulmonary obstructive disease patients suggests that membrane-associated proteins like mscL may play crucial roles in adaptation to host environments, potentially contributing to its pathogenicity mechanisms.

How does B. petrii mscL compare structurally to other bacterial mechanosensitive channels?

Based on comparative analyses with other bacterial species, B. petrii's large-conductance mechanosensitive channel likely contains the conserved transmembrane domains characteristic of bacterial mscL proteins. The channel typically exists as a homopentamer with each subunit containing two transmembrane segments connected by a periplasmic loop, with cytoplasmic N-terminal and C-terminal domains. What makes B. petrii mscL particularly intriguing is its potential structural adaptations that may correlate with the organism's environmental versatility and clinical persistence. The genomic plasticity observed in B. petrii isolates suggests that structural variations in membrane proteins like mscL might contribute to the phenotypic differences observed between sequential clinical isolates, including differences in antibiotic susceptibility and immune recognition patterns.

What genomic features influence mscL expression in B. petrii isolates?

The expression of mscL in B. petrii likely correlates with the bacterium's documented genomic rearrangements. Studies of sequential B. petrii isolates from patients have demonstrated phenotypic differences in growth characteristics, antibiotic susceptibility profiles, and immunogenic protein expression . These variations suggest that gene expression regulatory networks may be significantly altered during infection. Researchers should note that promoter regions and transcriptional regulators affecting mscL expression may be subject to the same genomic instability that characterizes B. petrii. This genomic fluidity provides a unique opportunity to study how mechanosensitive channel expression might be modulated during adaptation to different environmental conditions or in response to host immune pressures, potentially contributing to the bacterium's persistent infection capabilities.

What are the recommended protocols for cloning and expressing recombinant B. petrii mscL?

For effective cloning and expression of recombinant B. petrii mscL, researchers should consider adapting established protocols for membrane protein expression. Based on successful approaches with other recombinant proteins, the following methodological considerations are recommended:

  • Vector selection: A proprietary pMH expression vector containing a modified human cytomegalovirus (CMV) promoter and enhancer has proven effective for transient expression of inserted gene sequences . Alternative vectors with kanamycin resistance genes for antibiotic selection may also be suitable.

  • Fusion tag strategy: Consider designing fusion constructs similar to those used for other recombinant proteins. For example, an IgG1 human Fc (hFc) tag could be fused in-frame downstream of the final codon of B. petrii mscL . This approach facilitates purification and detection while potentially preserving protein functionality.

  • Expression systems: Heterologous expression in E. coli may be challenging due to the hydrophobic nature of membrane proteins. Consider mammalian expression systems for more complex studies of channel function.

  • Purification approach: For membrane proteins like mscL, detergent-based extraction followed by affinity chromatography targeting fusion tags represents a standard approach.

What protocols are most effective for functional characterization of recombinant B. petrii mscL?

For functional characterization of recombinant B. petrii mscL, researchers should employ multiple complementary approaches:

  • Electrophysiological methods: Patch clamp analysis of reconstituted channels in liposomes or after expression in mammalian cells provides direct measurement of channel conductance properties. This approach permits assessment of channel opening thresholds in response to membrane tension.

  • Osmotic shock assays: These provide a physiologically relevant assessment of channel function. Bacterial cells expressing recombinant mscL can be subjected to hypoosmotic shock, and survival rates compared to control cells. This approach assesses the channel's ability to mediate solute efflux under osmotic stress.

  • Fluorescence-based assays: Calcein release assays using mscL-reconstituted liposomes can provide a high-throughput method for screening channel activity under various conditions, including potential inhibitors or modulators.

  • Immunological characterization: Given that B. petrii isolates show differences in recognition by patient antibodies , analyzing antibody binding to extracellular portions of mscL may reveal potential epitope variations that could influence host-pathogen interactions.

How does the adaptive genomic plasticity of B. petrii affect mscL function during infection?

The documented genomic rearrangements in B. petrii isolates present a fascinating context for studying mscL adaptations during infection. Sequential B. petrii isolates from a single patient have demonstrated differences in growth characteristics, antibiotic susceptibility profiles, and recognition by patient antibodies . These observations suggest that membrane protein modifications, potentially including mscL, might contribute to adaptive responses during infection persistence.

Research approaches to investigate this question should include:

  • Comparative genomic analysis of sequential isolates to identify potential genetic variations in the mscL gene and its regulatory regions.

  • Transcriptomic profiling to assess differential expression of mscL under various environmental conditions that mimic host niches.

  • Site-directed mutagenesis studies of identified mscL variants to assess functional consequences on channel gating properties, sensitivity to membrane tension, or interactions with antimicrobial compounds.

  • In vivo infection models using mouse systems to correlate mscL variations with colonization efficiency, similar to the approaches used in previous B. petrii studies .

What is the relationship between B. petrii mscL function and antibiotic resistance?

The observation that sequential B. petrii isolates exhibit differences in antibiotic susceptibility raises intriguing questions about the potential role of mechanosensitive channels in antibiotic resistance. Mechanosensitive channels can influence cell membrane permeability, potentially affecting antibiotic entry or efflux. Research approaches to investigate this relationship should include:

  • Correlation analysis between mscL sequence variants/expression levels and minimum inhibitory concentrations (MICs) for various antibiotics.

  • Comparative studies of antibiotic accumulation in bacterial cells with wild-type versus mutant mscL channels.

  • Investigation of potential interactions between mscL and known antibiotic resistance mechanisms, such as efflux pumps or membrane modification systems.

  • Assessment of mscL expression changes following antibiotic exposure, particularly in response to antibiotics that target cell wall synthesis or membrane integrity.

Several clinical isolates have shown discrepancies between in vitro susceptibility testing and therapeutic outcomes , suggesting complex resistance mechanisms that might involve membrane permeability factors like mscL.

What are the key considerations for isolating and maintaining B. petrii strains for mscL research?

When working with B. petrii for mscL research, several methodological considerations are crucial:

  • Strain selection and verification: Given the genomic plasticity of B. petrii, researchers should verify isolate identity through 16S rRNA gene sequencing. The 1,486 nucleotide sequence of the small subunit rRNA gene shows approximately 99.3% similarity (1,468/1,479 nt) with the type strain of B. petrii .

  • Growth conditions optimization: B. petrii isolates have demonstrated variable growth characteristics , necessitating optimization of culture conditions. Standard Bordetella growth media may require modification for optimal growth of clinical versus environmental isolates.

  • Genetic stability monitoring: Regular verification of genetic stability during laboratory passage is essential, given the documented propensity for genomic rearrangements. Monitoring of key genetic markers, such as the risA and ompA genes , is recommended.

  • Biosafety considerations: As B. petrii has been associated with various clinical infections , appropriate biosafety protocols should be followed, typically BSL-2 practices at minimum.

What techniques are most effective for analyzing mscL mutations in the context of B. petrii genomic plasticity?

Given the documented genomic rearrangements in B. petrii , specialized approaches for analyzing mscL mutations are necessary:

  • Long-read sequencing: Technologies such as PacBio or Oxford Nanopore sequencing are recommended for capturing large-scale genomic rearrangements that might affect the mscL gene locus or its regulatory elements.

  • Comparative genomic analysis: When analyzing sequential isolates, as described in previous B. petrii studies , comparative genomics should focus not only on point mutations but also on potential insertion sequences, genomic islands, or other mobile genetic elements that might influence mscL expression or function.

  • Transcriptomic profiling: RNA-Seq analysis of isolates under various stresses can identify differential expression patterns of mscL and potentially co-regulated genes.

  • Targeted verification: For specific mscL mutations identified through whole-genome approaches, targeted PCR and Sanger sequencing should be employed to verify mutations before functional studies are initiated.

How can researchers reconcile contradictory findings in antibody recognition studies of B. petrii proteins?

Studies of B. petrii have revealed interesting contradictions in antibody recognition patterns, with some isolates being poorly recognized by patient antibodies despite persistent infection . When investigating antibody recognition of membrane proteins like mscL, researchers should consider these methodological approaches:

  • Multiple antibody sources: Compare reactivity patterns using sera from both the source patient and from experimental animal models. Previous research demonstrated that antibodies from mice inoculated with B. petrii strains recapitulated the specificity and strain-dependent responses seen with patient serum .

  • Protein-specific epitope mapping: Identify specific epitopes recognized by antibodies, particularly focusing on extracellular portions of membrane proteins like mscL that would be accessible to antibodies during infection.

  • Analysis of surface antigen modifications: Consider potential post-translational modifications or conformational changes that might affect antibody recognition. Previous work has identified mutations affecting lipopolysaccharide O-antigen that influenced antibody recognition of B. petrii .

  • Time-course serology: When available, analyze sequential serum samples to track the evolution of antibody responses over time, which may reveal epitope shifting or immunodominance patterns.

How should researchers address contradictory results in antimicrobial susceptibility testing of B. petrii?

Clinical studies of B. petrii have revealed significant discrepancies between in vitro susceptibility testing and therapeutic outcomes . For example, one case showed successful clinical outcome with clarithromycin despite the isolate being resistant in vitro . When investigating antimicrobial effects on B. petrii, particularly in relation to membrane proteins like mscL, researchers should:

  • Employ multiple testing methodologies: Combine disk diffusion, broth microdilution, and Etest methods to generate a comprehensive susceptibility profile. Reference MICs should be established using standardized methods .

  • Correlate in vitro and in vivo findings: Consider that in vitro resistance doesn't necessarily predict clinical failure, as demonstrated in previous B. petrii cases .

  • Investigate potential adaptation mechanisms: Test for inducible resistance or tolerance by exposing cultures to sub-inhibitory concentrations of antimicrobials before susceptibility testing.

  • Consider membrane permeability factors: Specifically investigate how mscL expression or function might influence antimicrobial entry into the bacterial cell, potentially explaining discrepancies between in vitro susceptibility and in vivo efficacy.

This approach acknowledges the complexity of antimicrobial susceptibility patterns observed in clinical B. petrii isolates and explores the potential contribution of mechanosensitive channels to these phenomena.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.