Recombinant Bordetella petrii Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

General Overview of YidC Function

Membrane protein insertase YidC catalyzes the insertion of proteins into the prokaryotic plasma membrane through highly specialized mechanisms. Unlike the Sec translocase, which operates as a transmembrane channel that can open laterally to bind and release hydrophobic segments of substrate proteins into the lipid bilayer, YidC insertases employ a different approach. These insertases interact with their substrates in a distinctive groove-like structure at an amphiphilic protein-lipid interface, facilitating the sliding of transmembrane segments of the substrate directly into the lipid bilayer . This mechanism represents a fundamental process in bacterial physiology, enabling the transition of proteins from the aqueous cytoplasmic environment to the hydrophobic membrane environment.

The YidC protein demonstrates remarkable conservation across bacterial species, highlighting its evolutionary significance. Recent high-resolution structures of YidC have provided critical insights into the mechanistic details of how transmembrane proteins achieve the transition from the aqueous cytoplasm to the hydrophobic lipid bilayer environment of the membrane . These structural revelations have enhanced our understanding of membrane protein biogenesis and the crucial role played by insertases in this process.

YidC in Bacterial Systems

YidC can function both independently as a membrane protein insertase and collaboratively with the SecY complex during co-translational membrane protein integration . This dual functionality underscores the versatility of YidC in facilitating membrane protein insertion across diverse bacterial systems. The process typically occurs co-translationally, with the nascent protein chain being inserted into the membrane as it emerges from the ribosome. This co-translational integration is mediated by the universally conserved YidC protein, which plays a crucial role in the proper assembly of membrane proteins essential for bacterial survival and function.

Taxonomy and Characteristics

Bordetella petrii belongs to the genus Bordetella, which consists of small (0.2–0.7 μm) Gram-negative coccobacilli within the phylum Proteobacteria . Unlike most other Bordetella species, which are obligate aerobes and highly fastidious (difficult to culture), B. petrii represents a notable exception to this pattern . This distinction makes B. petrii particularly interesting for research purposes, as it offers a more accessible model for studying this genus.

The Bordetella genus, named after Jules Bordet, includes several species capable of infecting humans. The first three described species (B. pertussis, B. parapertussis, and B. bronchiseptica) are sometimes referred to as the "classical species" and are well-known respiratory pathogens . Transmission of Bordetella typically occurs through direct contact, respiratory aerosol droplets, or fomites, with initial bacterial adherence to ciliated epithelial cells in the nasopharynx mediated by various protein adhesins.

Clinical Significance of Bordetella petrii

Bordetella petrii has emerged as a pathogen of clinical interest due to its unique adaptive capabilities. Initially discovered in environmental samples, B. petrii has subsequently been isolated from clinical specimens associated with jaw infections, ear bone conditions, cystic fibrosis, and chronic pulmonary diseases . The bacterium's ability to undergo massive genomic rearrangements contributes to its adaptability in various environments, including within human hosts.

Research has documented the isolation of B. petrii from sequential respiratory samples and a post-mortem spleen sample of a patient with bronchiectasis and cavitary lung disease associated with nontuberculous mycobacterial infection . Studies comparing these successive B. petrii strains revealed differences in growth characteristics, antibiotic susceptibility patterns, and recognition by the patient's antibodies, demonstrating the remarkable in vivo adaptability of this organism . This adaptability may facilitate immune response evasion and support persistent infection, highlighting the clinical importance of understanding B. petrii at the molecular level.

Functional Mechanisms

Bordetella petrii YidC operates through mechanisms common to the YidC family of insertases. During protein insertion, YidC interacts with nascent membrane proteins emerging from the ribosome, guiding their integration into the bacterial membrane . This process is critical for the assembly of functional membrane protein complexes that contribute to bacterial virulence, survival, and antibiotic resistance.

Structural models of YidC-ribosome complexes reveal how this insertase facilitates the transition of nascent membrane proteins from the ribosome to the lipid bilayer. During co-translational membrane protein insertion, YidC docks with the ribosome, creating a protected environment where the hydrophobic transmembrane segments of the nascent protein can be properly oriented and inserted into the membrane . This process ensures the correct topology and folding of integral membrane proteins essential for bacterial cell function.

Research Applications

Recombinant Bordetella petrii YidC serves as a valuable tool for studying membrane protein biogenesis and bacterial pathogenicity. The availability of this protein in a recombinant form (labeled as VAng-Lsx2684 in commercial catalogs) enables researchers to investigate its structure, function, and potential as a therapeutic target . Its applications span various fields, including structural biology, microbiology, cellular biology, and infectious disease research.

The recombinant protein can be used to:

  1. Study membrane protein insertion mechanisms in bacteria

  2. Investigate the role of YidC in Bordetella virulence

  3. Develop assays for screening potential antimicrobial compounds

  4. Generate antibodies for detecting native YidC in bacterial samples

  5. Perform structural studies to elucidate the precise molecular architecture of this insertase

Vaccine Development Considerations

The adaptability of Bordetella petrii in vivo, including changes in its surface antigens that affect recognition by the host immune system, presents both challenges and opportunities for vaccine development . Research has identified strains of B. petrii with defects in lipopolysaccharide O-antigen that are poorly recognized by patient antibodies, pointing to potential mechanisms of immune evasion that would need to be considered in any vaccine development strategy targeting this organism .

Functional Differences and Similarities

While the core function of YidC as a membrane protein insertase is conserved across bacterial species, subtle differences in structure and substrate specificity may exist between Bordetella petrii YidC and its homologs in other bacteria. These differences could potentially influence the efficiency of membrane protein insertion or the range of substrates recognized by the insertase.

The adaptability of Bordetella petrii in clinical settings suggests that its YidC protein may participate in the bacterium's ability to respond to environmental changes and immune pressures . Further comparative studies of YidC function across Bordetella species could elucidate how variations in this protein might contribute to differences in pathogenicity, host adaptation, and environmental persistence among members of this genus.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
yidC; Bpet5011; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-563
Protein Length
full length protein
Species
Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Target Names
yidC
Target Protein Sequence
MDIRRTILWMIFSFSLLLLWNNWQIHNGKPSLFGTPPASSAASPAEGQQAAANGQAATPS VPTTPAAAAASTVPGATAAPAAAKVEQVVVSTDVLRLTFDTTGAQLIRAELLKYPTSGQP NKPTVLLDRSPELTYVVQSGLVGAPNGQSFPNHQTPFRLVSTDHELKGDSLQVVFEADSG GLKVTKTYTLHRGRYDIDVQHSLANTSDAPLAPSLYLQLERDGNDPADTSSFYHTFTGVA VYSEQDKFQKITFSDIAKGKGSYIKQADNGWLAVVQHYFATAWVPPQGKQRTNELLQVQP NLYAARSIEAVGTVQPGATAQVDSRLWVGPQDQKAMAAVAPGLELVVDYGWLTIIAKPLF SLLTWLHSLLGNWGWAIVALTVIIKAVFFPLAAASYRSMARMKQVAPRLQALKEKYGDDR QKLNQAMMEMYRTEKINPLGGCLPMVVQIPVFIALYWVLLASVEMRGAPWILWVHDLSVR DPYFILPAVMMATMFLQIKLNPTPPDPIQAKVMMIMPLVFGGMMFFFPAGLVLYWCVNNT LSIAQQWTITRNLQRKAEAAANR
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It participates in the integration of membrane proteins dependent on and independent of the Sec translocase complex, and aids in the folding of multispanning membrane proteins, including certain lipoproteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its functional significance in bacteria?

YidC is a membrane protein insertase that plays a pivotal role in the integration, folding, and assembly of numerous proteins, particularly energy-transducing respiratory complexes. It functions both independently and in concert with the SecYEG translocon in bacteria . The YidC family of proteins is highly conserved across all domains of life, emphasizing its fundamental importance in cellular biology . In bacteria, YidC is essential for viability, as demonstrated in E. coli where it was shown to be required for the insertion of phage proteins that were previously thought to insert spontaneously .

The functional significance of YidC lies in its ability to catalyze the energetically unfavorable movement of polar domains across the hydrophobic lipid bilayer and to act as a chaperone ensuring proper protein folding into functional conformations . YidC is approximately five times more abundant than the SecYEG complex in bacterial cells, highlighting its critical importance in membrane protein biogenesis .

What is the structural organization of Bordetella petrii YidC?

Bordetella petrii YidC consists of a conserved 5-transmembrane core structure that forms a unique hydrophilic cavity in the inner leaflet of the membrane bilayer. This cavity is accessible from both the cytoplasm and the lipid phase . The full-length protein consists of 563 amino acids with several distinct regions .

Based on structural models of YidC homologs, the protein is threaded back-and-forth through the membrane a total of five times, with portions extending into the bacterial cytoplasm . This arrangement creates a structure where hydrophobic residues on the exterior of the transmembrane bundle stabilize interactions with the apolar lipid tails, while the core is stabilized through interactions between the five helices .

The residues toward the cytoplasmic side of the core are primarily polar or charged, engaged in strong electrostatic interactions, while residues on the periplasmic side are primarily aromatic, involved in stacking and other nonpolar dispersion interactions . This structural arrangement is crucial for YidC's function in membrane protein insertion.

How does YidC facilitate membrane protein insertion?

YidC facilitates membrane protein insertion through two main pathways:

  • YidC-only pathway: YidC can independently insert certain membrane proteins, particularly those with short translocated regions followed by one or two transmembrane segments . Examples of substrates that use this pathway include Pf3 coat protein, M13 procoat protein, subunit c of ATP synthase, the mechanosensitive channel protein MscL, and C-terminal tail-anchored proteins like TssL, DjlC, and Flk .

  • SecYEG-associated pathway: YidC also works in concert with the SecYEG translocon to facilitate the insertion, folding, and assembly of more complex membrane proteins . In this pathway, YidC interacts with SecY via its transmembrane helix 1 (TM1) and the C1 loop .

The insertion mechanism involves a unique hydrophilic cavity formed by YidC's transmembrane core, which is accessible from both the cytoplasm and the lipid phase . This arrangement allows YidC to shield the hydrophilic portions of substrate proteins during membrane passage while facilitating the correct positioning of transmembrane segments in the lipid bilayer.

What experimental approaches can be used to study YidC-substrate interactions?

Several advanced experimental approaches can be employed to study YidC-substrate interactions:

  • Cross-linking Studies: Chemical cross-linking with agents like DSS (disuccinimidyl suberate) or site-specific cross-linking using photo-reactive amino acid analogs like pBpa (p-benzoyl-L-phenylalanine) can capture transient interactions between YidC and its substrates . This approach has been successfully used to identify contact points between YidC and SecY, revealing interactions via TM1 and the C1 loop .

  • Co-expression Systems: Developing co-expression systems for YidC and potential substrate proteins allows for studying interactions under more physiological conditions. This approach can overcome stoichiometric limitations when studying interactions with less abundant partners like the SecYEG complex .

  • Evolutionary Covariation Analysis: This computational approach identifies pairs of residues that have co-evolved, suggesting physical proximity in the folded protein. This method has successfully predicted helix-helix contacts in YidC, providing insights into its structure-function relationships .

  • Molecular Dynamics (MD) Simulations: MD simulations can model the behavior of YidC in a lipid bilayer environment, providing insights into protein stability, flexibility, and interactions with both the membrane and substrate proteins . These simulations can identify key residues involved in stabilizing the protein structure or in substrate interactions.

  • Cryo-electron Microscopy: This technique has been used to visualize YidC-ribosome complexes, revealing how YidC interacts with ribosomes during co-translational membrane insertion of nascent proteins .

What are the critical residues for YidC function and how can they be experimentally validated?

Molecular dynamics simulations and experimental validation have identified several critical residues essential for YidC function:

  • Key Stabilizing Residues:

    • T362 in TM2 and Y517 in TM6 are particularly crucial. Alanine mutations at these positions completely inactivate YidC despite stable expression of the mutant proteins .

    • Other residues with intermediate effects on activity include F433, M471, and F505 .

  • Experimental Validation Methods:

    • In vivo Complementation Assays: This approach tests whether mutated versions of YidC can rescue the growth of YidC-depleted strains. This method effectively identifies residues critical for function, as demonstrated for T362 and Y517 .

    • Protein Stability Assays: Western blotting can confirm whether loss of function is due to protein instability or direct functional impairment .

    • Site-directed Mutagenesis: Systematic replacement of conserved residues with alanine or other amino acids can map the functional landscape of YidC .

ResidueLocationEffect of Alanine MutationProposed Function
T362TM2Complete loss of functionStructural stability
Y517TM6Complete loss of functionStructural stability
F433-Intermediate activitySupporting role
M471-Intermediate activitySupporting role
F505-Intermediate activitySupporting role
  • Interaction Mapping: Cross-linking experiments combined with mass spectrometry can identify residues that directly contact substrate proteins or partner proteins like SecY .

How does the Bordetella petrii YidC compare to YidC homologs from other bacteria?

Comparative analysis of YidC from Bordetella petrii with homologs from other bacteria reveals both conserved features and species-specific adaptations:

  • Conserved Structure: All bacterial YidC proteins share the conserved 5-transmembrane core structure that forms the characteristic hydrophilic cavity . This conservation underscores the fundamental mechanistic principles underlying YidC function across different bacterial species.

  • Sequence Variability: Despite structural conservation, sequence analysis shows variability, particularly in loop regions and at the N-terminus. The Bordetella petrii YidC sequence (Uniprot ID: A9IJB7) can be aligned with other bacterial YidCs to identify both conserved and variable regions .

  • Functional Conservation: The mechanistic details uncovered in model organisms like E. coli are generally applicable to YidC homologs in other bacteria due to the conserved nature of these insertases . This functional conservation allows researchers to apply insights from well-studied systems to less characterized homologs like Bordetella petrii YidC.

  • Experimental Approaches for Comparative Studies:

    • Complementation assays to test functional interchangeability

    • Chimeric proteins combining domains from different YidC homologs to identify species-specific functional elements

    • Comparative structural modeling based on evolutionary covariation analysis

    • Heterologous expression systems to study the function of Bordetella petrii YidC in model organisms

What challenges exist in expressing and purifying functional recombinant Bordetella petrii YidC?

Expression and purification of functional membrane proteins like Bordetella petrii YidC present several challenges that researchers must address:

  • Expression System Selection:

    • E. coli-based systems are commonly used but may not always correctly fold heterologous membrane proteins

    • Cell-free expression systems can offer advantages for toxic membrane proteins

    • Expression levels must be optimized to avoid overwhelming the host cell's membrane protein insertion machinery

  • Solubilization and Stabilization:

    • Appropriate detergent selection is crucial for maintaining YidC structure and function during extraction from membranes

    • Nanodiscs or amphipols can provide more native-like environments for functional studies

    • Storage conditions (buffer composition, temperature) significantly impact stability

  • Functional Verification:

    • Activity assays using model substrates are needed to confirm that purified YidC retains insertion activity

    • Structural integrity assessment using circular dichroism or limited proteolysis

  • Storage Considerations:

    • Recombinant Bordetella petrii YidC should be stored at -20°C, or at -80°C for extended storage periods

    • Addition of 50% glycerol and use of Tris-based buffers optimized for this specific protein can enhance stability

    • Repeated freeze-thaw cycles should be avoided, with working aliquots kept at 4°C for up to one week

  • Quality Control:

    • Size exclusion chromatography to verify monodispersity

    • Mass spectrometry to confirm sequence integrity and post-translational modifications

What methodological approaches can be used to study YidC-dependent membrane insertion in vitro?

Several sophisticated methodological approaches can be employed to study YidC-dependent membrane insertion in vitro:

  • Reconstituted Proteoliposome Systems:

    • YidC can be reconstituted into liposomes to create a minimal system for studying insertion activity

    • This approach has successfully demonstrated YidC's ability to independently insert substrates like Pf3 coat protein

    • The lipid composition can be carefully controlled (e.g., 3 POPE to 1 POPG ratio commonly used for bacterial membrane modeling)

    • Fluorescence-based assays can monitor insertion kinetics in real-time

  • Co-translational Insertion Assays:

    • Coupled transcription-translation systems combined with YidC-containing proteoliposomes

    • Allows study of insertion during active protein synthesis, mimicking the natural process

    • Can be combined with site-specific labeling techniques to track insertion intermediates

  • Biophysical Characterization:

    • Förster resonance energy transfer (FRET) to measure distances between YidC and substrate proteins during insertion

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during the insertion process

    • Single-molecule techniques to observe individual insertion events

  • Computational Approaches:

    • Molecular dynamics simulations can model membrane thinning, protein-lipid interactions, and conformational changes during insertion

    • These simulations can be validated using experimental approaches like hydrogen bond analysis and interaction energy measurements

  • Structural Studies:

    • Cryo-electron microscopy of YidC-ribosome-nascent chain complexes

    • X-ray crystallography of YidC in complex with substrate peptides

    • NMR studies of specific domains or segments to understand dynamic aspects of insertion

How can recombinant Bordetella petrii YidC be used in membrane protein folding studies?

Recombinant Bordetella petrii YidC provides a valuable tool for investigating fundamental aspects of membrane protein folding:

  • Comparative Folding Studies:

    • Using Bordetella petrii YidC alongside other bacterial YidC homologs can reveal species-specific aspects of membrane protein folding

    • This approach can identify conserved folding mechanisms versus specialized adaptations

    • Model substrates with varying complexities can be used to probe the folding capabilities of different YidC homologs

  • Reconstitution Systems:

    • Purified recombinant YidC can be incorporated into synthetic membrane systems with defined compositions

    • This allows systematic investigation of how lipid environment affects YidC-mediated folding

    • Co-reconstitution with SecYEG can enable studies of the cooperative folding pathway

  • Real-time Folding Assays:

    • Fluorescence-based approaches using environmentally sensitive probes

    • FRET-based distance measurements to track conformational changes during folding

    • Single-molecule force spectroscopy to measure energetics of YidC-assisted folding

  • Structural Analysis:

    • Hydrogen-deuterium exchange mass spectrometry to map folding intermediates

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling to track conformational changes

    • Time-resolved cryo-EM to capture folding intermediates

  • Computational Modeling:

    • Molecular dynamics simulations of YidC-substrate interactions during the folding process

    • Analysis of the hydrophilic cavity's role in shielding hydrophilic segments during membrane insertion

What insights can be gained from comparing YidC-only and SecYEG-YidC-dependent insertion pathways?

Comparative analysis of YidC-only and SecYEG-YidC-dependent insertion pathways provides crucial insights into membrane protein biogenesis mechanisms:

  • Substrate Specificity Determinants:

    • YidC-only pathway substrates typically contain short translocated regions followed by one or two transmembrane segments

    • More complex proteins with larger periplasmic domains often require the SecYEG-YidC cooperative pathway

    • Systematic analysis of chimeric substrates can identify specific features that dictate pathway selection

  • Energetic Requirements:

    • The YidC-only pathway may have different energetic requirements compared to the SecYEG-dependent pathway

    • Studies can investigate ATP/GTP dependencies and proton motive force requirements for each pathway

    • Thermodynamic analyses can quantify energy landscapes of insertion via different pathways

  • Kinetic Differences:

    • Real-time insertion assays can reveal differences in insertion rates between the two pathways

    • Single-molecule approaches can identify rate-limiting steps in each pathway

    • Pulse-chase experiments can track pathway-specific intermediates

  • Structural Interactions:

    • YidC interacts with SecY primarily through TM1 and the C1 loop

    • Crosslinking and co-purification studies have shown these interactions can be stabilized by reagents like paraformaldehyde (PFA)

    • The complete YidC-SecYEG holotranslocon structure remains to be fully elucidated

  • Evolutionary Implications:

    • The YidC-only pathway may represent an evolutionarily more ancient membrane protein insertion mechanism

    • Comparative genomics across diverse bacterial species can reveal co-evolution patterns of YidC and SecYEG systems

    • Analysis of minimal genomes can identify the core essential components of each pathway

How can mutations in YidC be analyzed to understand structure-function relationships?

Systematic mutational analysis provides powerful insights into YidC structure-function relationships:

  • Alanine Scanning Mutagenesis:

    • Systematic replacement of residues with alanine to identify functionally critical positions

    • Key residues like T362 in TM2 and Y517 in TM6 have been identified as essential for YidC function

    • Results can be mapped onto structural models to identify functional hotspots

  • Complementation Assays:

    • In vivo assays testing whether mutant YidC variants can rescue growth in YidC-depleted strains

    • This approach can distinguish between mutations that completely abolish function versus those with partial effects

    • Quantitative growth measurements can provide nuanced understanding of mutation severity

  • Domain Swapping:

    • Creating chimeric proteins by swapping domains between YidC homologs

    • This approach can identify species-specific functional elements

    • Combined with mutagenesis, it can pinpoint critical residues within functional domains

  • Correlation with Structural Features:

    • Molecular dynamics simulations can predict how mutations affect protein stability and dynamics

    • Interaction energy analysis can identify residues important for structural integrity

    • Membrane thickness analysis can reveal how mutations affect YidC-lipid interactions

  • Evolutionary Context:

    • Comparative analysis of natural sequence variation across homologs

    • Correlation of conserved residues with experimentally identified functional positions

    • Evolutionary coupling analysis to identify co-evolving residue networks

What emerging technologies could advance our understanding of YidC function?

Several cutting-edge technologies hold promise for deepening our understanding of YidC function:

  • Cryo-Electron Tomography:

    • Visualization of YidC in its native membrane environment

    • Capturing different functional states during the insertion process

    • Studying YidC distribution and organization in bacterial membranes

  • Advanced Computational Approaches:

    • Machine learning algorithms to predict substrate specificity and insertion efficiency

    • Enhanced molecular dynamics simulations incorporating quantum mechanical calculations for more accurate modeling of critical interactions

    • Integration of evolutionary data with structural modeling for improved predictions

  • High-Throughput Mutagenesis:

    • Deep mutational scanning to comprehensively map the effects of all possible amino acid substitutions

    • Coupling with selection systems to identify mutations affecting specific aspects of YidC function

    • CRISPR-based approaches for genome-wide identification of genetic interactions

  • Single-Molecule Techniques:

    • Single-molecule FRET to track conformational changes during insertion

    • Optical tweezers to measure forces involved in membrane protein insertion

    • Super-resolution microscopy to visualize YidC dynamics in living cells

  • Time-Resolved Structural Methods:

    • Time-resolved cryo-EM to capture insertion intermediates

    • Serial crystallography using X-ray free electron lasers (XFELs) to obtain structural snapshots during insertion

    • Hydrogen-deuterium exchange mass spectrometry with millisecond time resolution

How might comparative studies of YidC across different bacterial species inform therapeutic strategies?

Comparative studies of YidC across bacterial species could inform novel therapeutic approaches:

  • Antimicrobial Development:

    • Identification of species-specific features in pathogen YidC proteins that could be targeted by selective inhibitors

    • Disruption of YidC function could impair bacterial membrane protein biogenesis, potentially leading to novel antibacterial strategies

    • Structural comparison between bacterial and human homologs can guide development of pathogen-specific interventions

  • Species-Specific Vulnerabilities:

    • Some pathogens may rely more heavily on either YidC-only or SecYEG-YidC pathways

    • These differential dependencies could be exploited in targeted therapeutic approaches

    • Systematic analysis of YidC essentiality across different growth conditions and infection models

  • Vaccine Development:

    • Surface-exposed epitopes of YidC could potentially serve as vaccine targets

    • Identification of conserved epitopes across multiple pathogenic species could lead to broader-spectrum vaccines

    • Expression systems for recombinant YidC domains as potential immunogens

  • Diagnostic Applications:

    • Species-specific antibodies against YidC could aid in rapid pathogen identification

    • Detection of YidC expression levels in clinical samples could provide insights into bacterial physiological state

    • Monitoring YidC mutations associated with antimicrobial resistance

  • Heterologous Expression Systems:

    • Engineering bacteria with optimized YidC systems for improved production of therapeutic membrane proteins

    • Development of recombinant protein expression systems utilizing efficient insertion machinery

    • Biotechnological applications leveraging insights from natural diversity in YidC function

What challenges remain in understanding the complete functional cycle of YidC-mediated membrane insertion?

Despite significant advances, several challenges remain in fully understanding YidC-mediated membrane insertion:

  • Capturing Insertion Intermediates:

    • The transient nature of insertion intermediates makes them difficult to isolate and characterize

    • Time-resolved structural studies are needed to capture the dynamic insertion process

    • Development of methods to trap functionally relevant intermediates without disrupting natural dynamics

  • Energetics and Thermodynamics:

    • The precise energetic contributions driving YidC-mediated insertion remain incompletely understood

    • Quantitative measurements of insertion energetics under various conditions are needed

    • Understanding how YidC alters the energy landscape for membrane protein insertion

  • Regulatory Mechanisms:

    • How YidC activity is regulated in response to cellular conditions remains unclear

    • Potential post-translational modifications affecting YidC function

    • Mechanisms coordinating YidC with other cellular processes like protein translation

  • Complete Substrate Spectrum:

    • Comprehensive identification of all natural YidC substrates across different bacterial species

    • Understanding the rules governing substrate recognition and pathway selection

    • Development of predictive models for YidC dependency based on substrate features

  • Structural Dynamics:

    • The exact mechanism by which substrate proteins move through YidC remains to be elucidated

    • How conformational changes in YidC facilitate membrane insertion

    • Coordination between YidC and SecYEG in the holotranslocon complex

  • Species-Specific Adaptations:

    • How YidC function has evolved across diverse bacterial phyla

    • Specialized adaptations in extremophiles and pathogens

    • Functional differences between Bordetella petrii YidC and well-studied model systems

What factors should be considered when designing experiments with recombinant Bordetella petrii YidC?

Designing robust experiments with recombinant Bordetella petrii YidC requires careful consideration of several factors:

  • Protein Preparation and Quality:

    • Verify protein integrity before experiments using SDS-PAGE and Western blotting

    • Assess aggregation state using size exclusion chromatography or dynamic light scattering

    • Store according to recommended conditions (-20°C for standard storage, -80°C for extended storage)

    • Use the optimized storage buffer with 50% glycerol and Tris-based components

    • Avoid repeated freeze-thaw cycles, and maintain working aliquots at 4°C for up to one week

  • Expression Systems:

    • Consider codon optimization for the expression host if using heterologous systems

    • Evaluate different fusion tags (His, FLAG, etc.) for their potential impact on function

    • For co-expression studies with partner proteins like SecYEG, carefully balance expression levels

  • Functional Assays:

    • Include appropriate positive and negative controls in all assays

    • Consider using well-characterized YidC substrates as benchmarks (e.g., Pf3 coat protein, M13 procoat)

    • Validate results with multiple complementary approaches (e.g., crosslinking, functional assays, structural studies)

  • Membrane Environment:

    • For in vitro studies, the lipid composition significantly impacts YidC function

    • A ratio of 3 POPE to 1 POPG has been successfully used to model bacterial membranes in simulations

    • Consider native Bordetella petrii membrane composition for more physiologically relevant studies

  • Partner Proteins:

    • When studying interactions with SecYEG, consider stoichiometric relationships (YidC is normally ~5 times more abundant)

    • For ribosome binding studies, ensure ribosomes are active and properly programmed with appropriate nascent chains

How can researchers troubleshoot common issues in YidC functional assays?

Troubleshooting common issues in YidC functional assays requires systematic approaches:

  • Low Insertion Activity:

    • Check protein integrity using SDS-PAGE and Western blotting

    • Verify correct folding using circular dichroism or limited proteolysis

    • Optimize detergent conditions if working with purified protein

    • Consider membrane composition in reconstituted systems

    • Test activity with well-characterized substrates as positive controls

  • Inconsistent Results:

    • Standardize protein preparation protocols to minimize batch-to-batch variation

    • Control temperature precisely during assays

    • Use internal standards in each experiment

    • Consider freeze-thaw effects and minimize sample handling

    • Maintain consistent buffer conditions across experiments

  • Poor YidC-Substrate Interactions:

    • Verify substrate protein integrity and proper folding

    • Optimize binding conditions (salt concentration, pH, temperature)

    • Consider using chemical crosslinking to stabilize transient interactions

    • Try alternative substrate proteins known to interact with YidC

  • Challenges in Co-expression Systems:

    • Balance expression levels of YidC and partner proteins

    • Consider inducible promoters with titratable expression

    • Verify co-expression using Western blotting for all components

    • Optimize induction timing and conditions

  • Mutant Protein Analysis:

    • Check expression levels and stability of mutant proteins

    • Perform complementation assays to verify in vivo function

    • Consider partial loss-of-function using quantitative assays

    • Use multiple mutations to identify synergistic effects

ProblemPossible CausesTroubleshooting Approach
No insertion activityInactive protein, improper reconstitutionCheck protein integrity, optimize membrane composition
Weak binding signalTransient interactions, suboptimal conditionsUse crosslinking, optimize binding buffer
Poor expressionToxicity, codon usage, protein instabilityOptimize expression system, use fusion tags
Inconsistent resultsSample variation, experimental conditionsStandardize protocols, include internal controls
Mutations with no effectFunctional redundancy, robust systemTry multiple mutations, use more sensitive assays

What critical controls should be included when studying YidC-substrate interactions?

Rigorous experimental design for studying YidC-substrate interactions requires several critical controls:

  • Protein Quality Controls:

    • Size exclusion chromatography to verify monodispersity

    • Circular dichroism to confirm secondary structure

    • Activity assays with well-characterized substrates to confirm functionality

    • Western blotting to verify full-length protein expression

  • Interaction Specificity Controls:

    • Non-substrate proteins to demonstrate binding specificity

    • Competition assays with known substrates vs. non-substrates

    • Gradient of substrate concentrations to demonstrate saturable binding

    • Mutated substrate variants lacking key recognition elements

  • System-specific Controls:

    • For crosslinking: no-crosslinker controls and non-specific crosslinking controls

    • For co-purification: stringent washing controls and non-tagged protein controls

    • For in vivo assays: vector-only controls and catalytically inactive YidC mutants

    • For reconstituted systems: protein-free liposome controls

  • YidC Variant Controls:

    • Wild-type YidC as a positive control

    • Catalytically inactive mutants (e.g., T362A or Y517A) as negative controls

    • YidC homologs from other species to test conservation of interactions

    • Truncated YidC variants to map interaction domains

  • Environmental Controls:

    • Temperature dependence to verify physiologically relevant interactions

    • Salt concentration series to distinguish electrostatic from hydrophobic interactions

    • pH dependence to identify critical protonation states

    • Time course experiments to capture dynamic interactions

Including these controls ensures that observed interactions are specific, physiologically relevant, and directly attributable to YidC function rather than experimental artifacts or non-specific effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.