Recombinant Bordetella petrii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
nuoK; Bpet1687; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Target Names
nuoK
Target Protein Sequence
MTLTLAHYLVLGAILFAIGIFGIFLNRRNLIILLMSIELVLLAVNMNFVAFSSWFGDTAG QVFVFFILTVAAAEAAIGLAILVLLFRNLNTINVDELDRLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. This process is coupled with proton translocation, whereby for every two electrons transferred, four hydrogen ions are transported across the cytoplasmic membrane. This mechanism conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of nuoK subunit in NADH-quinone oxidoreductase of Bordetella petrii?

The nuoK subunit of NADH-quinone oxidoreductase (NDH-1) in Bordetella petrii serves as an integral membrane component critically involved in proton translocation. Research indicates that nuoK, together with subunits NuoA, NuoJ, and NuoH, forms a proton-pumping machinery bundle essential for energy conversion. Studies on homologous systems demonstrate that nuoK contains charged residues that participate directly in the coupling mechanism linking electron transfer to proton translocation across the membrane .

The significance of nuoK becomes evident in knockout studies, which show that removal of this subunit results in complete loss of assembled NDH-1 complexes, highlighting its essential role in complex stability and assembly. The nuoK-KO mutant displays negligible dNADH-O₂ (2% of wild-type), dNADH-DB (3% of wild-type), and dNADH-UQ₁ (5% of wild-type) reductase activities, confirming nuoK's indispensable role in catalytic function .

In B. petrii specifically, the adaptation to both aerobic and anaerobic environments likely requires specialized modulations of its respiratory complexes, potentially involving unique structural or functional adaptations of the nuoK subunit that facilitate energy conservation under variable oxygen conditions .

How do conserved glutamate residues contribute to nuoK function in energy transduction?

Two glutamate residues in nuoK—Glu-36 and Glu-72—play crucial roles in the energy transduction process of NDH-1. Located in transmembrane helices TM2 and TM3 respectively, these residues participate in proton translocation pathways .

Glu-36 is perfectly conserved across species, indicating its fundamental importance to nuoK function. Mutagenesis studies demonstrate that E36A and E36Q mutations result in almost complete abolishment of energy-transducing NDH-1 activities. Specifically, the E36A mutation reduces dNADH-O₂ reductase activity to merely 3% of wild-type levels, while maintaining 86% of dNADH-K₃Fe(CN)₆ reductase activity. This suggests that while the peripheral arm assembles correctly, the proton translocation function is severely compromised .

Glu-72, while almost perfectly conserved, appears less critical as E72A mutations cause only partial loss of activity (approximately 52% of wild-type dNADH-O₂ reductase activity). This suggests a supporting rather than essential role in the proton translocation mechanism .

Experimental data from position-switching mutations provides further insight. When glutamate is repositioned within TM2 (as in mutants E36A/L32E, E36A/M38E, and E36A/I39E), partial rescue of activity occurs, with these mutants showing 52%, 69%, and 75% of wild-type dNADH-O₂ reductase activity respectively. This positional flexibility suggests that the precise location of charged residues within the transmembrane domain allows for some functional adaptation .

What techniques are most effective for expressing and purifying recombinant Bordetella petrii nuoK?

Successful expression and purification of recombinant Bordetella petrii nuoK requires carefully optimized protocols due to its hydrophobic nature as a membrane protein. The most effective expression systems for nuoK include Escherichia coli, yeast, baculovirus, or mammalian cell platforms .

For E. coli expression systems, specialized strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) are recommended to minimize toxicity. Expression constructs should incorporate affinity tags (histidine or strep-tag) positioned to avoid interference with transmembrane domains. Induction conditions require careful optimization, typically using lower IPTG concentrations (0.1-0.5 mM) and reduced temperatures (16-25°C) to promote proper folding .

Membrane isolation represents a critical step, requiring gentle cell disruption methods followed by differential centrifugation to separate membrane fractions. Solubilization of nuoK from membranes necessitates screening multiple detergents, with mild non-ionic detergents (DDM, LMNG) or zwitterionic detergents (CHAPS, FC-12) typically yielding better results for maintaining protein stability and functionality .

For analyzing correct assembly of the expressed protein, blue native polyacrylamide gel electrophoresis (BN-PAGE) combined with activity staining and immunoblotting using anti-nuoK antibodies provides validation of proper folding and integration into complexes. Functional validation can be performed through measurement of dNADH-K₃Fe(CN)₆ reductase activity, which specifically assesses the assembly of the hydrophilic domain of NDH-1 .

How does the anaerobic growth capability of Bordetella petrii affect its respiratory complexes?

Bordetella petrii's unique ability to grow under anaerobic conditions—a characteristic that distinguishes it from other strictly aerobic Bordetella species—likely necessitates specialized adaptations in its respiratory complexes, including NDH-1 and its nuoK subunit .

Under anaerobic conditions, B. petrii must utilize alternative electron acceptors in place of oxygen, potentially requiring modifications to its respiratory chain components. The flexible metabolism of B. petrii suggests that its NADH-quinone oxidoreductase might possess structural adaptations that enable efficient electron transfer across varying oxygen tensions. These adaptations may include alterations in quinone-binding sites, proton translocation pathways, or regulatory mechanisms that optimize energy conservation under different growth conditions .

Research approaches to investigate these adaptations include comparative proteomic analysis of B. petrii respiratory complexes grown under aerobic versus anaerobic conditions, measurement of NDH-1 activity across varying oxygen concentrations, and structural studies to identify unique features of B. petrii respiratory complex subunits. Additionally, gene expression analysis can reveal differential regulation of respiratory complex components under changing environmental conditions .

The facultative anaerobic nature of B. petrii provides a valuable model system for understanding respiratory complex evolution and adaptation, potentially revealing mechanisms by which strict aerobes could have evolved towards metabolic flexibility .

What is the importance of the charged residues in loop-1 of nuoK for complex function?

The small cytosolic loop-1 of nuoK contains three residues of particular interest: Arg-25, Arg-26, and Asn-27. Among these, Arg-25 demonstrates high conservation across species, suggesting functional significance .

Site-directed mutagenesis studies reveal that mutations in these residues significantly impact NDH-1 activity while maintaining complex assembly. Specifically, the R25A mutation reduces dNADH-O₂ reductase activity to approximately 55% of wild-type levels. Similar effects are seen with other mutations (R25K: 67%, R25C: 69%, R25S: 58%), confirming the importance of this residue regardless of the specific amino acid substitution .

The following table summarizes the effects of various loop-1 mutations on NDH-1 activity:

MutationdNADH-O₂ (% of WT)dNADH-DB (% of WT)dNADH-UQ₁ (% of WT)dNADH-K₃Fe(CN)₆ (% of WT)
WT100 ± 6%100 ± 1%100 ± 0%100 ± 1%
R25A55 ± 4%54 ± 1%73 ± 6%85 ± 2%
R25K67 ± 4%58 ± 2%78 ± 7%97 ± 1%
R25C69 ± 5%53 ± 3%81 ± 8%91 ± 1%
R25S58 ± 3%51 ± 1%64 ± 1%87 ± 1%
R26A72 ± 2%68 ± 4%73 ± 6%98 ± 0%
R26K80 ± 6%81 ± 2%95 ± 8%106 ± 1%
R26C81 ± 7%70 ± 2%88 ± 7%106 ± 5%
R26S73 ± 3%70 ± 4%89 ± 10%92 ± 1%

These results indicate that while loop-1 mutations significantly affect energy-transducing activities (dNADH-O₂, dNADH-DB, dNADH-UQ₁), they have minimal impact on peripheral arm assembly and function (dNADH-K₃Fe(CN)₆), suggesting a specific role in the coupling mechanism rather than in structural stability .

What experimental approaches are most effective for studying the proton translocation function of nuoK in B. petrii?

Investigating proton translocation through the nuoK subunit requires sophisticated experimental approaches that can correlate structure with function at the molecular level. Based on current research methodologies, several approaches have proven particularly effective:

Site-directed mutagenesis combined with functional assays represents a powerful approach for identifying residues involved in proton translocation. Creating a series of systematic mutations targeting conserved charged residues (particularly glutamates) and measuring the resulting impact on coupled activities provides insight into potential proton pathways. For example, the "glutamate relocation" strategy (EAE mutations) used in NDH-1 research effectively maps functional domains by repositioning critical residues within transmembrane helices .

Proton pumping efficiency can be directly measured using pH-sensitive fluorescent probes (ACMA, pyranine) to detect pH changes in proteoliposomes containing reconstituted nuoK or NDH-1 complexes. This approach allows quantification of proton/electron (H⁺/e⁻) ratios, which directly reflects coupling efficiency .

For structural insights, hydrogen/deuterium exchange mass spectrometry (HDX-MS) can identify solvent-accessible regions and conformational changes associated with proton movement. This technique provides dynamic information complementary to static structural methods .

Computational approaches including molecular dynamics simulations can model proton transfer pathways through nuoK, particularly when parameterized with experimental data from mutagenesis studies. These simulations can reveal water wire formations, protonation state changes, and conformational dynamics associated with proton movement .

The combination of these approaches creates a comprehensive experimental framework for elucidating the molecular details of proton translocation through nuoK in Bordetella petrii NDH-1, particularly when adapted to account for the unique anaerobic capabilities of this organism .

How do site-directed mutations of conserved glutamate residues in B. petrii nuoK affect enzyme activity and complex assembly?

The impact of glutamate mutations in nuoK on NADH-quinone oxidoreductase activity and assembly provides critical insights into the functional architecture of this complex. Extensive mutagenesis studies reveal a complex relationship between glutamate position and enzyme function .

Mutation of the highly conserved Glu-36 to alanine (E36A) results in near-complete loss of coupled electron transfer activities (reducing dNADH-O₂ reductase activity to 3% of wild-type) while maintaining peripheral arm assembly (86% dNADH-K₃Fe(CN)₆ activity). This indicates Glu-36 is specifically essential for energy transduction rather than complex stability .

Systematic repositioning of glutamate residues through double mutations (E36A combined with introduction of glutamate at neighboring positions) reveals position-dependent rescue of function. The following table illustrates this relationship:

MutantdNADH-O₂ (% of WT)dNADH-DB (% of WT)dNADH-UQ₁ (% of WT)dNADH-K₃Fe(CN)₆ (% of WT)
WT100 ± 6%100 ± 1%100 ± 0%100 ± 1%
E36A3 ± 0%5 ± 0%7 ± 2%86 ± 2%
E36A/L32E (EAE2)52 ± 1%57 ± 1%56 ± 5%101 ± 5%
E36A/M38E (EAE7)69 ± 1%68 ± 2%65 ± 7%87 ± 4%
E36A/I39E (EAE8)75 ± 2%49 ± 0%60 ± 7%101 ± 2%
E36A/N40E (EAE9)47 ± 6%57 ± 3%77 ± 3%78 ± 1%

Notably, positioning a glutamate at positions 32, 38, 39, or 40 substantially rescues activity, suggesting these locations can participate in proton translocation pathways. In contrast, positions 31, 33, 34, 35, 37, and 41 show minimal rescue when containing glutamate residues, indicating these positions are not suitably positioned within the proton pathway .

Similar studies with Glu-72 mutations show more modest effects, with E72A reducing activity to 52% of wild-type levels. Repositioning experiments around this site show varying degrees of functional rescue, further supporting the importance of precise positioning of charged residues within transmembrane domains .

Immunoblotting and Blue Native PAGE analyses confirm that none of these mutations significantly affects complex assembly, indicating that the observed functional effects reflect specific disruption of proton translocation pathways rather than assembly defects. This methodological approach effectively separates structural from functional roles of conserved residues .

What methodological challenges exist in resolving the structure of membrane-bound subunits like nuoK in NADH-quinone oxidoreductase?

Determining the high-resolution structure of membrane-bound subunits like nuoK presents several significant technical challenges that require specialized methodological approaches to overcome:

Protein expression and purification represents the first major hurdle, as membrane proteins like nuoK often express poorly and tend to aggregate when removed from their native membrane environment. Optimization of heterologous expression systems is critical, with options including E. coli, yeast, insect cells, or mammalian cells, each offering different advantages for membrane protein production .

Detergent selection dramatically impacts both extraction efficiency and protein stability. Systematic screening of detergent types (ionic, non-ionic, zwitterionic) and concentrations is essential for optimal solubilization that preserves native structure. Newer approaches using nanodiscs, amphipols, or styrene-maleic acid copolymer lipid particles (SMALPs) offer alternatives that better maintain the native lipid environment around membrane proteins .

Crystallization of membrane proteins for X-ray crystallography remains challenging due to limited polar surface area for crystal contacts. Techniques to improve crystallization include creating fusion proteins with crystallizable soluble domains, using antibody fragments to increase polar surfaces, and employing lipidic cubic phase crystallization methods specifically designed for membrane proteins .

Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative that avoids crystallization requirements, but still faces challenges with smaller membrane proteins like nuoK (approximately 11 kDa). Recent advances in direct electron detectors and image processing algorithms have improved resolution capabilities for smaller proteins, though often nuoK is best visualized as part of the entire NDH-1 complex rather than in isolation .

Nuclear magnetic resonance (NMR) spectroscopy offers advantages for smaller membrane proteins but requires extensive isotopic labeling (¹⁵N, ¹³C, ²H) and optimization of membrane mimetics to achieve sufficient spectral quality. Solution NMR faces size limitations, while solid-state NMR can overcome size constraints but presents other technical challenges .

Computational approaches including homology modeling and molecular dynamics simulations provide complementary structural insights, particularly when experimental data is limited. These methods can predict structural features and dynamic behaviors when parameterized with biochemical and functional data from mutagenesis studies .

How can comparative analyses reveal evolutionary adaptations of nuoK in facultative anaerobes like B. petrii versus obligate aerobes?

The unique metabolic flexibility of Bordetella petrii—capable of growth under both aerobic and anaerobic conditions—provides a valuable model system for investigating evolutionary adaptations in respiratory complex components. Comparative analyses across Bordetella species can reveal how nuoK has evolved to accommodate variable respiratory environments .

Sequence analysis represents the foundation of comparative studies, examining conservation patterns of key residues across species with different respiratory capabilities. While Glu-36 is universally conserved across both obligate and facultative aerobes (suggesting a fundamental role in NDH-1 function), other residues may show specific conservation patterns correlating with respiratory flexibility. Multiple sequence alignment tools coupled with conservation scoring algorithms can identify these species-specific adaptations .

Structural homology modeling based on resolved structures from related organisms allows prediction of three-dimensional differences in nuoK architecture. Particular attention should focus on transmembrane helices, loop regions, and residues involved in subunit interfaces, as these may reveal adaptations for function under variable oxygen tensions .

Functional comparisons through heterologous expression and activity assays can directly test the performance of nuoK variants from different species. By expressing B. petrii nuoK in obligate aerobic hosts and measuring activity under varying oxygen conditions, researchers can quantify functional differences and correlate them with structural features .

Analysis of quinone-binding characteristics may reveal particularly important adaptations, as facultative anaerobes must interact with different quinone types depending on oxygen availability. Binding studies using radiolabeled or fluorescent quinone analogs can identify differences in quinone specificity between B. petrii and obligate aerobic Bordetella species .

Transcriptomic and proteomic profiling under aerobic versus anaerobic conditions can reveal regulatory adaptations that govern nuoK expression and post-translational modifications in response to environmental oxygen. These approaches provide a systems-level view of how respiratory flexibility is achieved .

What approaches can elucidate the interaction between nuoK and other membrane subunits in the complete complex?

Understanding the interactions between nuoK and other membrane subunits in NADH-quinone oxidoreductase requires integrative structural and functional approaches that can capture both static architecture and dynamic associations:

Chemical cross-linking coupled with mass spectrometry represents a powerful approach for mapping protein-protein interactions within membrane complexes. By using bifunctional cross-linkers with varying spacer lengths, researchers can identify specific residues involved in subunit interfaces. Application to nuoK can reveal its contacts with neighboring subunits NuoA, NuoJ, and NuoH, which together are proposed to form a proton-pumping module .

Co-immunoprecipitation studies using antibodies against nuoK can identify interaction partners when performed under mild solubilization conditions that preserve native complexes. Sequential co-immunoprecipitation with antibodies against different subunits can further establish the assembly pathway and interaction hierarchy within the membrane domain .

Genetic suppressor analysis provides functional evidence of subunit interactions. By introducing a detrimental mutation in nuoK and screening for compensatory mutations in other subunits that restore function, researchers can identify residues involved in functional coupling between subunits. This approach has successfully identified interactions between respiratory complex subunits in various systems .

Site-specific photocrosslinking using unnatural amino acids (like p-benzoyl-L-phenylalanine) incorporated at specific positions in nuoK can capture transient interactions with neighboring subunits. This technique offers higher spatial resolution than chemical crosslinking and can detect dynamic interactions that occur during the catalytic cycle .

Blue Native PAGE combined with second-dimension SDS-PAGE provides information about subcomplexes that form during assembly or disassembly. Analysis of complex formation in various nuoK mutants can reveal how specific residues contribute to interactions with other subunits. The research has shown that NuoK-KO mutants completely fail to assemble NDH-1, confirming nuoK's essential role in complex stability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.