Recombinant Bordetella petrii Protein CrcB homolog (crcB)

How is recombinant Bordetella petrii CrcB homolog protein typically produced for research applications?

For research applications, the recombinant B. petrii CrcB homolog protein is typically produced using E. coli expression systems . The standard production process involves:

• Cloning and Expression: The full-length crcB gene (spanning amino acids 1-128) is cloned into an expression vector with an N-terminal His-tag to facilitate purification .

• Culture Conditions: Transformed E. coli are grown under optimized conditions for protein expression, typically using IPTG induction in rich media .

• Purification: The expressed protein is purified using affinity chromatography, taking advantage of the His-tag, followed by additional purification steps if needed .

• Quality Control: The purified protein undergoes SDS-PAGE analysis to confirm purity (typically >90%) .

• Storage Preparation: The purified protein is typically prepared in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 and lyophilized for long-term stability .

What are the optimal storage and handling conditions for recombinant CrcB homolog protein?

To maintain the stability and functionality of recombinant B. petrii CrcB homolog protein, the following storage and handling conditions are recommended:

• Storage Temperature: Store the lyophilized protein at -20°C/-80°C upon receipt .

• Aliquoting: Aliquot the protein upon reconstitution to minimize freeze-thaw cycles, as repeated freezing and thawing is not recommended .

• Working Aliquots: Store working aliquots at 4°C for up to one week .

• Reconstitution: Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

• Glycerol Addition: Add glycerol to a final concentration of 5-50% for long-term storage at -20°C/-80°C (50% is the default recommendation) .

• Preparation for Use: Briefly centrifuge the vial prior to opening to bring contents to the bottom .

How should researchers design experiments to study the ion transport function of CrcB homolog protein?

Designing experiments to study the ion transport function of CrcB homolog requires a multi-faceted approach:

• Membrane Reconstitution Systems:

  • Incorporate purified CrcB homolog into liposomes or nanodiscs to create artificial membrane systems

  • Use fluorescent dyes sensitive to ion concentrations (particularly fluoride) to monitor transport activity

  • Implement ion selective electrodes to directly measure ion flux across membranes

• Mutagenesis Studies:

  • Design site-directed mutagenesis of key residues in the transmembrane regions, particularly focusing on conserved amino acids between position 50-90 where the putative channel/pore region likely exists

  • Create truncated versions to identify minimal functional domains

• Block Design Experimental Approach:

  • Implement block design experiments with fixed duration tasks alternating with rest periods

  • Ensure consistent durations that account for the time required for signal stabilization

  • Control for periodic physiological confounds by maintaining similar conditions between test and control periods

• Complementation Assays:

  • Express CrcB homolog in bacterial strains deficient in fluoride transport

  • Assess growth in media containing varying concentrations of fluoride ions

  • Compare wild-type and mutant protein variants for functional complementation

• Controls:

  • Include known fluoride transporters as positive controls

  • Use empty vector or inactive mutants as negative controls

  • Test specificity by examining transport of other ions

What are the optimal expression systems for functional studies of CrcB homolog protein?

When designing expression systems for functional studies of membrane proteins like CrcB homolog, researchers should consider:

• Prokaryotic Expression Systems:

  • E. coli: Most commonly used for initial expression due to rapid growth and high yield

  • B. petrii native expression: For studying the protein in its natural environment with proper post-translational modifications

  • Expression tags: His-tag positions (N-terminal vs C-terminal) should be tested to determine which minimally impacts function

• Eukaryotic Expression Systems:

  • Saccharomyces cerevisiae: For studying eukaryotic membrane insertion and processing

  • Mammalian cell lines: For interaction studies with eukaryotic cellular components

  • Insect cells (Sf9, Sf21): For higher expression of functional membrane proteins

• Cell-Free Expression Systems:

  • Particularly useful for toxic membrane proteins

  • Allows direct incorporation into nanodiscs or liposomes during synthesis

• Induction and Growth Conditions:

  • Temperature optimization (typically lower temperatures for membrane proteins)

  • Induction timing and concentration

  • Membrane-promoting additives (e.g., glycerol, specific detergents)

• Extraction and Purification Considerations:

  • Detergent selection critical for maintaining native folding

  • Mild solubilization conditions to preserve function

  • Purification strategy that minimizes time protein spends in detergent

What techniques are most effective for studying the membrane topology of CrcB homolog protein?

To determine the membrane topology of CrcB homolog protein, several complementary techniques should be employed:

• Computational Prediction:

  • Hydropathy analysis using algorithms such as TMHMM, Phobius, or MEMSAT

  • Analysis of the amino acid sequence (MTQTLIPLNFLAVAIGAALGACARWLAGLWLNSSAWPWGTLLVNLAGGYLIGLALAVLLAHPEWPQWIRLAAVTGFLGGLTTFSTFSAETVGMLERGAYATALGYAALSLVGSLALTALGLASAHALR) reveals multiple hydrophobic segments typical of membrane-spanning domains

• Biochemical Approaches:

  • Cysteine scanning mutagenesis combined with accessibility assays

  • Protease protection assays to identify exposed regions

  • Chemical labeling of accessible residues followed by mass spectrometry

• Structural Studies:

  • Cryo-electron microscopy for high-resolution structural determination

  • X-ray crystallography (challenging for membrane proteins but possible with appropriate crystallization conditions)

  • NMR spectroscopy for dynamic structural information

• Fluorescence-Based Methods:

  • FRET (Förster Resonance Energy Transfer) using strategically placed fluorophores

  • GFP-fusion reporter assays to determine orientation of protein termini

• Epitope Mapping:

  • Insertion of epitope tags at various positions followed by immunodetection in permeabilized versus non-permeabilized cells

How should researchers approach the analysis of CrcB homolog protein interactions with other cellular components?

To comprehensively analyze CrcB homolog protein interactions with other cellular components:

• Protein-Protein Interaction Studies:

  • Co-immunoprecipitation using His-tag antibodies for the recombinant protein

  • Bacterial two-hybrid systems

  • Proximity labeling approaches (BioID, APEX)

  • Cross-linking mass spectrometry to capture transient interactions

• Protein-Lipid Interaction Analysis:

  • Lipid binding assays to determine specific lipid requirements

  • Lipidomics analysis of co-purifying lipids

  • Reconstitution in different lipid compositions to assess functional impacts

• Localization Studies:

  • Fluorescence microscopy using tagged versions of CrcB

  • Immunogold electron microscopy for high-resolution localization

  • Subcellular fractionation followed by Western blotting

• Functional Association Studies:

  • Transcriptional profiling in CrcB knockout/overexpression models

  • Metabolomic analysis to identify affected pathways

  • Ion flux measurements in the presence of potential interaction partners

• Bioinformatic Approaches:

  • Gene neighborhood analysis in B. petrii genome

  • Coevolution analysis to identify functionally linked proteins

  • Structural modeling of potential protein complexes

How does the CrcB homolog in Bordetella petrii compare to CrcB proteins in other bacterial species?

The CrcB homolog in Bordetella petrii exhibits several important evolutionary and functional relationships when compared to CrcB proteins in other bacterial species:

• Sequence Conservation:

  • CrcB proteins are widely conserved across bacterial species, suggesting fundamental biological importance

  • The B. petrii CrcB homolog contains the characteristic membrane-spanning domains typical of the CrcB family

  • Key functional residues involved in ion selectivity are typically conserved across species

• Genomic Context:

  • The crcB gene in B. petrii (gene locus: Bpet3166) is found within the context of genomic islands carrying multiple genes involved in stress response and environmental adaptation

  • Unlike many pathogenic Bordetella species, B. petrii has acquired numerous mobile genetic elements and shows substantial genomic plasticity, suggesting environmental adaptation

• Evolutionary Significance:

  • B. petrii represents an evolutionary interesting position as it's primarily environmental while most Bordetella species are host-associated

  • Comparative genomic analysis shows that B. petrii has acquired genes for environmental survival through horizontal gene transfer, including stress response elements

• Functional Divergence:

  • The CrcB homolog likely contributes to B. petrii's ability to survive in diverse environments, including those with potentially toxic ion concentrations

  • May play a role in the bacterium's demonstrated ability to persist in both environmental and host contexts, as evidenced by clinical isolates maintaining colonization for extended periods

What insights can genomic analysis of Bordetella petrii provide about the evolution and function of CrcB homolog?

Genomic analysis of Bordetella petrii provides several key insights regarding the evolution and function of CrcB homolog:

• Genomic Islands and Horizontal Gene Transfer:

  • B. petrii contains multiple genomic islands carrying mobile genetic elements that have contributed to its environmental adaptability

  • These islands often carry genes involved in stress response, including ion homeostasis systems like CrcB

  • Comparative genomic analysis reveals that B. petrii has a more plastic genome compared to host-restricted Bordetella species

• Environmental Adaptation Signatures:

  • The genome of B. petrii carries numerous genes for heavy metal resistance, response regulators, transcription factors, and multi-drug efflux pumps

  • CrcB homolog (Bpet3166) is annotated as a putative fluoride ion transporter, suggesting a role in ion homeostasis under environmental stress conditions

  • The genomic context suggests CrcB functions as part of a broader stress response network

• Phylogenetic Relationships:

  • B. petrii represents a distinct evolutionary branch within the Bordetella genus

  • Average Nucleotide Identity (ANI) analysis shows that B. petrii strains form a distinct cluster from classical Bordetella pathogens like B. pertussis, B. parapertussis, and B. bronchiseptica

  • This divergence correlates with adaptation to different ecological niches (environmental vs. host-restricted)

• CrcB Conservation Patterns:

  • The conserved nature of CrcB across diverse bacterial species suggests an ancient origin predating the divergence of the Bordetella genus

  • The maintenance of this gene in both environmental and pathogenic species indicates an essential function that transcends specific lifestyles

What is the potential relevance of CrcB homolog in Bordetella petrii infections in humans?

While primarily considered an environmental species, B. petrii has been isolated from human clinical samples, raising questions about the role of proteins like CrcB homolog in infections:

• Clinical Significance:

  • B. petrii has been isolated from patients with chronic conditions such as cystic fibrosis and chronic obstructive pulmonary disease (COPD)

  • Case studies document persistent infection, with B. petrii isolated repeatedly from the same patient over periods exceeding one year

  • Unlike classical Bordetella pathogens, B. petrii appears to establish long-term persistence rather than acute infection

• Potential Role of CrcB in Persistence:

  • Ion transporters like CrcB may contribute to bacterial survival under the stress conditions found in human hosts

  • May help bacteria adapt to inflammatory environments where ion concentrations fluctuate

  • Could potentially be involved in biofilm formation, which is associated with persistent infections

• Host-Pathogen Interactions:

  • Western blot analysis using serum from a B. petrii-infected patient has demonstrated immune responses to specific B. petrii proteins

  • The immunogenicity of membrane proteins like CrcB homolog could contribute to the inflammatory response during infection

  • Understanding these interactions may help explain the persistent nature of B. petrii infections

• Antibiotic Resistance Considerations:

  • B. petrii isolated from clinical samples has shown resistance to multiple antibiotics

  • Membrane proteins like CrcB homolog could potentially contribute to this resistance through mechanisms such as altered membrane permeability

How might CrcB homolog be utilized in biotechnological applications?

The unique properties of CrcB homolog from B. petrii suggest several potential biotechnological applications:

• Bioremediation Applications:

  • B. petrii has demonstrated multi-metal resistance capabilities

  • Expression of CrcB homolog in other bacterial species might enhance their tolerance to toxic ions in contaminated environments

  • Engineered systems incorporating CrcB could potentially be used for fluoride or other ion removal from contaminated water sources

• Biosensor Development:

  • The ion transport function of CrcB could be exploited to develop biosensors for detecting specific ions

  • Coupling with reporter systems could allow for visual indication of ion concentrations

  • Potential applications in environmental monitoring, particularly for fluoride contamination

• Membrane Protein Expression Systems:

  • Insights from CrcB expression and folding could inform improved systems for other challenging membrane proteins

  • Structural elements that confer stability could be incorporated into chimeric proteins

• Drug Delivery Systems:

  • Ion channels and transporters like CrcB can potentially be incorporated into liposomes for controlled release systems

  • Understanding the gating mechanisms could allow for environmentally responsive delivery vehicles

• Protein Engineering:

  • The structural features of CrcB that allow ion selectivity could be modified to create proteins with novel ion specificities

  • Potential for creating synthetic biology tools for controlling ion homeostasis in engineered cells

What are the best approaches for studying CrcB homolog function under different environmental stress conditions?

To effectively study CrcB homolog function under various stress conditions, researchers should implement:

• Controlled Stress Response Studies:

  • Implement block design experiments where stress conditions (pH, temperature, ion concentrations) are alternated with recovery periods

  • Monitor gene expression changes in response to different stressors using RT-qPCR or RNA-seq

  • Compare wild-type and CrcB knockout/overexpression strains to assess specific contributions to stress tolerance

• Ion Homeostasis Measurements:

  • Use ion-selective electrodes or fluorescent indicators to directly measure ion concentrations

  • Monitor membrane potential changes under various stress conditions

  • Employ radioisotope uptake assays to quantify transport activity

• Structural Adaptations Analysis:

  • Implement hydrogen-deuterium exchange mass spectrometry to detect structural changes under different conditions

  • Use crosslinking studies to identify condition-dependent interaction partners

  • Apply molecular dynamics simulations to predict conformational changes under different ionic conditions

• Physiological Response Integration:

  • Connect CrcB function to broader cellular responses using metabolomics and transcriptomics

  • Monitor growth parameters and survival rates under varying stress conditions

  • Assess changes in membrane integrity and composition

• In vivo Relevance:

  • Transition from in vitro to cellular models, then to infection models where appropriate

  • Consider host-relevant conditions when designing experiments (e.g., conditions mimicking respiratory tract)

  • Monitor CrcB expression during infection using reporter constructs

How can researchers effectively design experiments to study the role of CrcB homolog in bacterial persistence during infection?

To investigate the role of CrcB homolog in bacterial persistence during infection, researchers should consider:

• Persistence Model Development:

  • Establish in vitro persistence models that mimic aspects of the infection environment

  • Create CrcB knockout and complemented strains to assess the specific contribution of CrcB to persistence

  • Compare with clinical isolates that have demonstrated long-term persistence in patients

• Tissue Culture Infection Models:

  • Use respiratory epithelial cell lines relevant to Bordetella infections

  • Implement both acute and long-term infection protocols

  • Assess adherence, invasion, and intracellular survival capabilities

• Immune Response Interactions:

  • Study interactions with immune cells (macrophages, neutrophils)

  • Assess the impact of CrcB expression on phagocytosis and intracellular survival

  • Investigate potential immunomodulatory effects

• Animal Infection Models:

  • Design experiments using animal models of respiratory infection

  • Implement competitive infection assays comparing wild-type and CrcB mutant strains

  • Monitor bacterial loads and persistence over extended time periods

• Clinical Sample Analysis:

  • Compare CrcB sequences and expression levels between acute and persistent clinical isolates

  • Perform longitudinal studies of B. petrii isolates from chronic infection cases

  • Use patient serum to identify immunogenic epitopes and potential vaccine targets

• Biofilm Formation Assessment:

  • Investigate the role of CrcB in biofilm formation under various conditions

  • Examine the spatial organization of CrcB within bacterial communities

  • Assess ion gradients within biofilm structures

What are the major technical challenges in working with recombinant CrcB homolog protein and how can they be addressed?

Working with membrane proteins like CrcB homolog presents several technical challenges that can be addressed through specific methodological approaches:

• Expression Challenges:

  Challenge: Low expression yields and protein misfolding

  Solutions:

  • Use specialized expression strains designed for membrane proteins (C41/C43, Lemo21)

  • Optimize growth temperatures (typically 16-30°C rather than 37°C)

  • Consider fusion partners that enhance folding and expression (MBP, SUMO)

  • Test different induction protocols (low IPTG concentrations, auto-induction media)

• Purification Difficulties:

  Challenge: Maintaining protein stability during extraction and purification

  Solutions:

  • Screen multiple detergents for optimal extraction (starting with mild detergents like DDM, LMNG)

  • Implement stringent temperature control during all purification steps

  • Add stabilizers such as glycerol (5-50%) and specific lipids

  • Consider native purification approaches that maintain the lipid environment

• Functional Assay Development:

  Challenge: Demonstrating transport activity in vitro

  Solutions:

  • Develop proteoliposome-based assays with appropriate fluorescent indicators

  • Implement electrophysiology techniques for direct measurement of transport

  • Design complementation assays in bacteria lacking endogenous ion transport systems

  • Use ion-selective electrodes for direct measurement of transport activity

• Structural Analysis Limitations:

  Challenge: Obtaining structural information for membrane proteins

  Solutions:

  • Screen multiple detergent/lipid combinations for crystallization trials

  • Consider lipidic cubic phase crystallization specifically designed for membrane proteins

  • Implement cryo-EM approaches which have revolutionized membrane protein structural biology

  • Use computational modeling informed by experimental constraints

• Experimental Design Considerations:

  Challenge: Implementing appropriate controls and conditions

  Solutions:

  • Design block experiments with appropriate controls for each experimental phase

  • Account for physiological confounds in the experimental design

  • Implement temperature and pH controls that mimic physiological conditions

  • Consider the potential impact of the His-tag on protein function and include tag-free controls where possible

How should contradictory results in CrcB homolog research be approached and resolved?

When facing contradictory results in CrcB homolog research, researchers should implement systematic approaches to resolve discrepancies:

• Methodological Standardization:

  • Compare experimental protocols in detail to identify critical differences

  • Standardize key methods across laboratories to ensure reproducibility

  • Implement robust positive and negative controls in all experiments

  • Consider interlaboratory testing of standardized protocols

• Protein Variant Considerations:

  • Verify the exact sequence and tag configuration used in different studies

  • Consider the impact of even minor sequence variations on protein function

  • Examine post-translational modifications that might differ between expression systems

  • Directly compare different protein preparations using identical functional assays

• Experimental Context Analysis:

  • Assess the impact of buffer conditions, pH, temperature, and ionic strength

  • Consider the lipid environment provided in different experimental setups

  • Evaluate the potential influence of interacting proteins present in some systems but not others

  • Examine the time course of measurements as kinetic differences may explain apparent contradictions

• Multi-technique Validation:

  • Apply complementary techniques to address the same research question

  • Prioritize direct measurements over indirect assessments

  • Implement both in vitro and in vivo approaches when possible

  • Consider the limitations of each technique when interpreting results

• Computational Modeling:

  • Use structural modeling to generate hypotheses that explain contradictory results

  • Implement molecular dynamics simulations to predict behavior under different conditions

  • Develop mathematical models of ion transport that can be tested experimentally

  • Use evolutionary analysis to identify conserved features that likely represent core functions

What are the most promising future research directions for understanding CrcB homolog function and applications?

The study of CrcB homolog from B. petrii presents several promising research avenues:

• Structural Biology Frontiers:

  • High-resolution structural determination of CrcB in different functional states

  • Cryo-EM analysis of CrcB within its native membrane environment

  • Structural basis of ion selectivity and gating mechanisms

  • Conformational changes associated with transport cycles

• Systems Biology Integration:

  • Network analysis of CrcB function within stress response pathways

  • Mathematical modeling of ion homeostasis incorporating CrcB transport kinetics

  • Multi-omics approaches to understand the broader impact of CrcB function

  • Connection between CrcB function and bacterial adaptation to changing environments

• Host-Pathogen Interaction Studies:

  • Role of CrcB in persistence during infection

  • Impact on immune cell function and inflammatory responses

  • Contribution to antibiotic tolerance or resistance

  • Potential as a therapeutic target in persistent Bordetella infections

• Synthetic Biology Applications:

  • Engineering CrcB variants with altered ion selectivity

  • Development of CrcB-based biosensors for environmental monitoring

  • Creation of synthetic channels with novel properties based on CrcB structure

  • Applications in controlled ion transport for cellular engineering

• Comparative Biology Approaches:

  • Functional comparison of CrcB homologs across the bacterial kingdom

  • Evolutionary analysis to trace the diversification of CrcB function

  • Identification of natural CrcB variants with unique properties

  • Cross-species complementation studies to identify functional conservation

How might advances in structural biology and computational methods enhance our understanding of CrcB homolog?

Recent and upcoming advances in structural biology and computational methods offer transformative opportunities for CrcB homolog research:

• Cryo-EM Revolution:

  • Single-particle cryo-EM now allows near-atomic resolution of membrane proteins without crystallization

  • Tomographic approaches can visualize CrcB in its native membrane environment

  • Time-resolved cryo-EM may capture different conformational states during transport

  • Direct visualization of lipid-protein interactions that modulate function

• Artificial Intelligence Applications:

  • AI-driven protein structure prediction (AlphaFold, RoseTTAFold) can generate high-confidence models

  • Machine learning approaches can predict functional sites and interaction partners

  • Deep learning analysis of sequence-function relationships across homologs

  • AI-assisted design of experiments to efficiently explore parameter space

• Advanced Simulation Approaches:

  • All-atom molecular dynamics simulations of CrcB in explicit membrane environments

  • Enhanced sampling methods to observe rare events in transport cycles

  • Quantum mechanics/molecular mechanics approaches for detailed ion coordination studies

  • Coarse-grained simulations to access longer timescales relevant to transport

• Integrative Structural Biology:

  • Combining multiple experimental techniques (cryo-EM, crystallography, NMR, SAXS)

  • Integrating sparse experimental data with computational models

  • In-cell structural studies using techniques like FRET and EPR

  • Cross-linking mass spectrometry to map protein-protein interaction networks

• Systems-Level Computational Approaches:

  • Whole-cell modeling incorporating CrcB transport kinetics

  • Simulation of ion homeostasis under various environmental conditions

  • Network analysis connecting CrcB function to broader cellular responses

  • Computational design of CrcB variants with enhanced or altered functions