Recombinant Bordetella petrii Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties of Recombinant uppP

Recombinant uppP is a 287-amino acid enzyme produced in E. coli and purified to >90% purity. Key characteristics include:

PropertyDetails
UniProt IDQ7WLL4 (B. bronchiseptica) / Unspecified for B. petrii (see )
Protein LengthFull-length (1–287 aa) for B. bronchiseptica; partial variants exist
TagN-terminal His tag for purification
Molecular Mass~31 kDa (simulated SDS-PAGE)
StorageLyophilized powder; store at -20°C/-80°C
FunctionDephosphorylates undecaprenyl diphosphate (UPP); confers bacitracin resistance

Functional Roles in Bacterial Metabolism

uppP catalyzes the hydrolysis of undecaprenyl diphosphate (UPP) to undecaprenyl monophosphate, a critical step in lipid carrier recycling for bacterial cell wall synthesis. This activity:

  • Enables Bacitracin Resistance: Bacitracin binds UPP, inhibiting peptidoglycan synthesis. uppP depletes UPP, rendering bacitracin ineffective .

  • Supports Metabolic Versatility: B. petrii leverages auxiliary pathways (e.g., gluconate degradation, denitrification) for survival in diverse environments, where uppP may contribute to lipid remodeling .

Expression Systems

Recombinant uppP is synthesized in E. coli via standard protocols, with yields optimized for structural and functional studies. Key parameters include:

  • Host Strain: E. coli BL21(DE3) or similar .

  • Purification: Nickel-affinity chromatography (His-tag) .

  • Reconstitution: Deionized water with glycerol (5–50%) for stability .

Research Focus Areas

ApplicationKey FindingsSources
Antibiotic ResistanceuppP mediates bacitracin resistance by depleting UPP pools.
Structural BiologyFull-length recombinant proteins enable crystallization for enzymatic studies
Genomic ContextB. petrii genomic islands (e.g., GI1–GI3) encode metabolic adaptability, but uppP is not directly linked to these regions

Comparative Analysis with Related Species

While B. petrii uppP shares functional homology with orthologs in B. bronchiseptica (Q7WLL4) and B. pertussis (Q7VXA0), key differences exist:

SpeciesUniProt IDLength (aa)FunctionSource
B. petriiN/A287Bacitracin resistance, lipid turnover
B. bronchisepticaQ7WLL4287Identical function to B. petrii
B. pertussisQ7VXA0PartialPartial homology; reduced resistance

Clinical Implications

  • Infection Dynamics: While B. petrii is rarely pathogenic, its persistence in immunocompromised hosts (e.g., mandibular osteomyelitis) highlights the need for understanding resistance mechanisms .

  • Antimicrobial Resistance: uppP’s role in bacitracin resistance underscores its potential as a target for novel antibiotics .

Biotechnological Uses

  • Enzyme Engineering: Recombinant uppP is used to study lipid carrier recycling and optimize bacterial metabolic pathways .

  • Industrial Applications: B. petrii’s metabolic versatility (e.g., aromatic compound degradation) positions uppP as a candidate for bioremediation .

Challenges and Future Directions

  • Genomic Instability: B. petrii’s genomic islands (e.g., GI3) exhibit instability, complicating long-term studies of uppP expression .

  • O-Antigen Variability: Mutations in LPS biosynthesis genes (e.g., B. petrii 3) may influence uppP’s role in environmental adaptation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life can vary depending on factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. Should you have specific tag type requirements, please inform us, and we will prioritize development accordingly.
Synonyms
uppP; Bpet3455; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Target Names
uppP
Target Protein Sequence
MTDSTLYLIKAFFLGIIEGLTEFIPVSSTGHLILIGDWINFTSSSGKVFEVVIQFGSILA VMWIFRARLWQLIRGTLTGVPAETAFTRNLLLAFLPAAVVGAIFIKTIKQVFYHPGVVAV TLVLGGLIMLWVERKTHHTPGDAPGAADDTASDERASAHTLEQISWKQALGVGVAQCLAM VPGTSRSGATIIGGMIAGIQRKTATEFSFFLAMPTMLGAATYDLYRNIDLLSQHDLSAIA VGFAAAFISALVVVRAVLRFVANHTYRGFAWYRIALGIVVAAWLMTK
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Undecaprenyl-diphosphatase (UppP) in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase (UppP) functions as a critical enzyme in the lipid II cycle of bacterial cell wall synthesis by dephosphorylating undecaprenyl pyrophosphate (UPP) to form undecaprenyl phosphate (UP). This dephosphorylation step is essential for recycling the lipid carrier and maintaining the integrity of the bacterial cell wall. Studies in Bacillus subtilis have demonstrated that UPP phosphatases constitute a vital link between cell envelope homeostasis and cell envelope stress response (CESR), highlighting their importance beyond basic cell wall synthesis . The UppP enzyme is particularly significant in Bordetella petrii due to this bacterium's unique environmental adaptation capabilities, unlike other Bordetella species which are obligate pathogens .

What genomic characteristics distinguish Bordetella petrii from other Bordetella species?

Bordetella petrii distinguishes itself from other members of the Bordetella genus by being the only species isolated from the environment, specifically river sediment, rather than from host organisms . This environmental origin correlates with B. petrii's exceptional ability to survive in river water for extended periods (up to 38 weeks with minimal viability decline), whereas pathogenic species like B. bronchiseptica show rapid viability loss in similar conditions . The B. petrii genome contains numerous mobile genetic elements, including at least seven large genomic islands (GIs), that encode accessory metabolic functions involved in aromatic compound degradation and heavy metal detoxification . These genomic elements, potentially including those encoding essential proteins like UppP, contribute to B. petrii's enhanced environmental adaptability and reflect its evolutionary history of extensive horizontal gene transfer .

How can recombinant B. petrii UppP be efficiently expressed for research purposes?

For efficient expression of recombinant B. petrii UppP, researchers should consider several methodological approaches based on the enzyme's characteristics. Expression systems utilizing E. coli BL21(DE3) with pET-based vectors under T7 promoter control are commonly effective for producing membrane-associated proteins like UppP. When designing expression constructs, incorporating an N-terminal His6-tag facilitates purification while maintaining enzymatic activity. Expression conditions should be optimized: induction at lower temperatures (16-20°C) often improves proper folding of membrane proteins, while expression in the presence of 0.5-1% glucose can help control basal expression levels. Additionally, consider using E. coli C43(DE3) or C41(DE3) strains, which are specifically adapted for expressing potentially toxic membrane proteins. Post-expression, membrane fractionation followed by detergent solubilization (typically with n-dodecyl-β-D-maltoside or Triton X-100) is critical for extracting functional UppP, as demonstrated in comparable studies with UPP phosphatases from other bacteria .

What is the relationship between UppP and antibiotic resistance in bacteria?

UPP phosphatases, including UppP, play a significant role in bacterial resistance to antibiotics that target cell wall synthesis, particularly bacitracin. In B. subtilis, while BcrC appears to be the primary UPP phosphatase contributing to bacitracin resistance, UppP also plays a supportive role in this mechanism . Bacitracin exerts its inhibitory effect by binding to UPP, which depletes the UP pool and ultimately arrests the lipid II cycle essential for cell wall synthesis . UPP phosphatases compete with bacitracin for the same target molecule (UPP), thus providing a layer of protection against the antibiotic. Research with B. subtilis demonstrated that although deletion of uppP alone had no measurable effect on bacitracin MIC, mutations limiting UPP phosphatase activity significantly reduced bacitracin resistance . This relationship suggests a potential research direction for understanding antibiotic resistance mechanisms in B. petrii, which may capitalize on its environmental adaptability and genetic flexibility shown through its numerous genomic islands .

What methods can be used to measure the enzymatic activity of recombinant B. petrii UppP?

The enzymatic activity of recombinant B. petrii UppP can be measured using several complementary approaches:

  • Phosphate Release Assay: This colorimetric method measures inorganic phosphate released during UPP dephosphorylation using malachite green or molybdate blue reagents, allowing quantification of enzymatic activity in real-time.

  • Radiolabeled Substrate Assay: Using [32P]-labeled UPP as substrate, researchers can quantify the conversion to UP through thin-layer chromatography or scintillation counting, providing highly sensitive detection of phosphatase activity.

  • HPLC Analysis: Separation and quantification of reactants (UPP) and products (UP) using reverse-phase HPLC enables precise measurement of reaction kinetics without radiolabeling.

  • Complementation Studies: Functional analysis can be performed by testing whether B. petrii uppP expression rescues growth defects in UPP phosphatase-deficient strains, similar to the complementation studies performed with B. subtilis phosphatase mutants .

  • Cell Envelope Stress Response (CESR) Reporter Systems: Since UPP phosphatase activity is linked to CESR, reporter constructs like the PσM that respond to cell envelope stress can indirectly measure functional activity, as demonstrated in B. subtilis studies .

Each method offers different advantages in terms of sensitivity, throughput, and physiological relevance, with the optimal approach depending on specific research objectives.

How do UppP and BcrC interact functionally in the context of the lipid II cycle?

UppP and BcrC exhibit complex functional interactions within the lipid II cycle, as evidenced by studies in B. subtilis. These phosphatases form an essential pair with synthetic lethality characteristics—while each can independently support bacterial growth, the simultaneous deletion of both genes is lethal . This relationship indicates that they perform overlapping but not identical functions in UPP dephosphorylation. BcrC appears to play the dominant role in maintaining resistance against the UPP-binding antibiotic bacitracin, while UppP demonstrates greater importance in sporulation processes . The functional relationship between these phosphatases also extends to cell envelope stress response (CESR): deletion of bcrC results in significantly increased activity of the σM-dependent PσM promoter, indicating elevated CESR, whereas uppP deletion shows a much milder effect . This suggests that BcrC serves as the primary UPP phosphatase under standard growth conditions, while UppP may fulfill a more specialized or backup role. Understanding these functional interactions provides important context for investigating UppP in B. petrii, particularly considering B. petrii's unique genomic characteristics and environmental adaptability .

What is the significance of genomic islands in B. petrii for UppP research?

The genomic islands (GIs) in B. petrii present unique opportunities and challenges for UppP research. B. petrii contains at least seven large genomic islands that are actively mobile, capable of excision from the chromosome, and in some cases, self-transmissible to other species . While the search results don't explicitly place uppP within these islands, the dynamic nature of B. petrii's genome significantly impacts research approaches. During standard laboratory culture, B. petrii frequently produces colony variants that have lost multiple genomic islands (as demonstrated with variants losing GI1, GI3, GI5, and GI6) . This genomic plasticity could potentially affect uppP expression if regulatory elements are encoded within these mobile regions or if genomic rearrangements alter gene expression patterns. Additionally, the capacity of B. petrii to receive and transfer genetic material (demonstrated by the conjugative transfer of GI3 to B. bronchiseptica) suggests potential horizontal transfer of genes like uppP or its regulators throughout the bacterium's evolutionary history . Researchers must therefore carefully characterize their B. petrii strains before and during UppP studies, as spontaneous genomic rearrangements could confound experimental results and interpretations.

How might the environmental adaptability of B. petrii influence UppP function and regulation?

The exceptional environmental adaptability of B. petrii likely influences UppP function and regulation in several significant ways. B. petrii demonstrates remarkable survival in river water for extended periods (up to 38 weeks) without significant viability decline, contrasting sharply with the rapid death of pathogenic Bordetella species in similar conditions . This environmental persistence capability suggests B. petrii possesses specialized cell envelope adaptation mechanisms that might involve modified UppP activity or regulation. The phosphate recycling function of UppP in the lipid II cycle becomes particularly crucial during environmental stress, when nutrients may be limited. Additionally, B. petrii's genome contains numerous mobile genetic elements encoding accessory metabolic functions that enhance environmental adaptation . These elements may influence uppP expression through global regulatory networks that respond to environmental changes. Given that UPP phosphatases in B. subtilis are integrated with cell envelope stress response pathways , B. petrii UppP might similarly connect environmental sensing with cell envelope homeostasis, potentially through unique regulatory mechanisms evolved for its environmental lifestyle. Furthermore, the frequent phenotypic variants observed during B. petrii culture suggest that UppP function might be modulated as part of adaptive responses to changing environmental conditions.

What experimental approaches can elucidate the synthetic lethality relationships of UppP in B. petrii?

Elucidating synthetic lethality relationships of UppP in B. petrii requires sophisticated experimental approaches given the essential nature of UPP phosphatase activity and B. petrii's genomic complexity. The following methodological approaches would be most effective:

  • Conditional Expression Systems: Implementing xylose-inducible (PxylA) or tetracycline-responsive expression systems for UppP and other potential synthetic lethal partners allows controlled depletion studies, similar to approaches used in B. subtilis .

  • CRISPR-dCas9 Knockdown Approach: Utilizing catalytically inactive Cas9 for targeted gene repression enables fine-tuned reduction in expression levels rather than complete deletion, as successfully applied for studying UPP phosphatases in B. subtilis .

  • Transposon Insertion Sequencing (TnSeq): This high-throughput approach can identify genes that cannot tolerate transposon insertions when uppP is deleted or depleted, revealing synthetic lethal or synthetic sick interactions.

  • Promoter Replacement Strategy: Replacing native promoters with titratable ones allows precise control of expression levels to identify the minimal threshold required for viability in different genetic backgrounds.

  • Cell Envelope Stress Response (CESR) Reporters: Integrating reporter constructs like PσM-lacZ to monitor CESR activation during UppP depletion provides insights into physiological consequences and potential compensatory mechanisms .

  • Whole Genome Sequencing of Suppressors: Analyzing spontaneous suppressor mutations that overcome growth defects in UppP-limited conditions can reveal compensatory pathways and functional relationships.

These complementary approaches would provide a comprehensive understanding of UppP's synthetic lethality network in the unique genomic context of B. petrii.

How do structural characteristics of B. petrii UppP contribute to its functional properties?

The structural characteristics of B. petrii UppP likely contribute significantly to its functional properties, although direct structural studies on B. petrii UppP specifically are not available in the provided search results. Based on UPP phosphatases studied in other bacteria, several structural features would be critical for B. petrii UppP function:

Structural FeatureFunctional SignificanceResearch Implications
Transmembrane DomainsProper membrane anchoring and substrate access to the lipid-water interfaceMutations affecting membrane insertion could disrupt activity while preserving protein expression
Active Site ArchitectureCoordination of metal ions (typically Mg²⁺) essential for phosphatase activityPoint mutations in metal-binding residues would provide insights into catalytic mechanism
Substrate-binding PocketSpecificity for UPP versus other phosphorylated lipidsStructure-guided mutations could alter substrate preference or reaction kinetics
Conformational FlexibilityPotential allosteric regulation and adaptation to membrane environmentDynamic studies using HDX-MS could reveal regulatory mechanisms
Oligomerization InterfacesPotential for forming functional dimers or higher-order structuresCross-linking studies could determine functional oligomeric state

Research approaches to investigate these structural features would include homology modeling based on related enzymes, site-directed mutagenesis of predicted catalytic residues, and membrane protein crystallization or cryo-EM studies. The unique environmental adaptability of B. petrii suggests its UppP might possess structural adaptations that enhance function under variable conditions, possibly including altered substrate binding pocket characteristics or unique regulatory domains compared to homologs from obligate pathogens.

What role might B. petrii UppP play in the bacterium's response to membrane-targeting stressors?

B. petrii UppP likely plays a crucial role in the bacterium's response to membrane-targeting stressors, based on findings in related systems. In B. subtilis, UPP phosphatases directly connect cell envelope homeostasis with the cell envelope stress response (CESR), with deletions affecting σM-dependent stress response activation . For B. petrii, with its exceptional environmental adaptability and long-term survival in water , this connection may be even more pronounced and specialized. UppP activity would be particularly important when facing membrane-disrupting compounds in environmental settings. Evidence from B. subtilis demonstrates that UPP phosphatase activity provides resistance against bacitracin by competing for UPP binding , suggesting B. petrii UppP may similarly contribute to resistance against naturally occurring antimicrobial compounds. Additionally, the lipid II cycle's role in peptidoglycan synthesis makes UppP function critical during cell envelope remodeling under stress conditions. B. petrii's genomic plasticity, evidenced by frequent phenotypic variants and mobile genomic islands , may also impact UppP expression or regulation during stress response. This genomic flexibility could allow B. petrii to rapidly adapt UppP function or expression levels in response to different environmental stressors, potentially contributing to its remarkable environmental persistence capabilities compared to pathogenic Bordetella species.

What controls should be included when characterizing recombinant B. petrii UppP activity?

Comprehensive characterization of recombinant B. petrii UppP activity requires a robust set of experimental controls to ensure reliable and interpretable results:

  • Negative Enzyme Controls:

    • Heat-inactivated UppP preparation to control for non-enzymatic substrate degradation

    • Catalytically inactive UppP mutant (e.g., predicted active site mutations) to distinguish specific enzymatic activity from potential contaminating phosphatases

    • Empty vector expression product processed identically to the UppP sample

  • Positive Enzyme Controls:

    • Well-characterized UPP phosphatase (e.g., BcrC or commercial alkaline phosphatase) tested in parallel

    • Complementation of UPP phosphatase-deficient bacterial strains, similar to the xylA-uppP complementation approach used in B. subtilis studies

  • Reaction Condition Controls:

    • Metal ion dependency analysis (EDTA chelation vs. specific metal supplementation)

    • pH optimization series to identify optimal reaction conditions

    • Detergent concentration series to control for micelle effects on substrate presentation

  • Substrate Specificity Controls:

    • Testing structurally related substrates to determine UppP specificity

    • Concentration series of UPP to determine kinetic parameters

  • Genetic Validation:

    • Complementation of B. subtilis uppP/bcrC mutants with B. petrii uppP to confirm functional conservation

    • Reporter system assays measuring CESR activation in response to UppP activity levels

Implementing these controls will help distinguish genuine B. petrii UppP activity from artifacts and provide context for interpreting experimental results within the broader understanding of UPP phosphatases.

How can evolutionary analysis inform the functional characterization of B. petrii UppP?

Evolutionary analysis provides crucial context for functional characterization of B. petrii UppP by revealing conservation patterns, adaptation signatures, and potential functional divergence. B. petrii's unique position as the only environmental Bordetella species with a highly mosaic genome shaped by extensive horizontal gene transfer makes evolutionary analysis particularly informative. Researchers should:

These evolutionary approaches can identify critical residues for functional studies, reveal potential environmental adaptations, and place B. petrii UppP within the broader context of bacterial cell wall biosynthesis evolution.

What are potential challenges in expressing and purifying recombinant B. petrii UppP?

Researchers working with recombinant B. petrii UppP may encounter several significant challenges during expression and purification processes:

ChallengePotential CauseTroubleshooting Approach
Low expression levelsToxicity due to membrane disruptionUse tightly controlled inducible systems; lower induction temperature (16-20°C); consider C41/C43 E. coli strains specialized for membrane proteins
Inclusion body formationProtein misfoldingExpress as fusion with solubility tags (MBP, SUMO); optimize induction conditions; consider cell-free expression systems
Poor extraction efficiencyStrong membrane associationTest different detergents (DDM, LDAO, Triton X-100); optimize detergent:protein ratios; use sequential detergent extraction
Loss of activity during purificationDetergent effects on protein structureInclude stabilizing lipids during purification; minimize purification steps; consider nanodisc reconstitution
Genetic instabilitySelection against toxic proteinSequence verify expression construct before and after induction; use low-copy vectors; include glucose to repress basal expression
Contaminating phosphatase activityHost phosphatasesInclude phosphatase inhibitors; develop specific activity assays; use negative controls with empty vector preparations
Genomic variability in source materialB. petrii's tendency to undergo genomic rearrangements Sequence verify the uppP gene from isolated genomic DNA; monitor strain stability during cultivation

The genomic plasticity of B. petrii, demonstrated by its ability to spontaneously lose genomic islands and generate phenotypic variants , presents an additional challenge that may affect the consistency of genetic material used for cloning uppP. Researchers should carefully verify their B. petrii strains and maintain rigorous quality control throughout the cloning and expression process.

How can researchers overcome challenges in studying synthetic lethality involving B. petrii UppP?

Studying synthetic lethality involving B. petrii UppP presents significant challenges due to the essential nature of UPP phosphatase activity and B. petrii's complex, dynamic genome. Researchers can implement several methodological approaches to overcome these challenges:

  • Implement Sophisticated Genetic Systems: Rather than attempting direct deletion of potentially synthetic lethal gene pairs, use tunable expression systems like the xylose-inducible system (PxylA) successfully employed in B. subtilis UPP phosphatase studies . This allows gradual depletion of UppP while monitoring effects on cell viability in various genetic backgrounds.

  • Develop Complementation Systems Before Deletion Attempts: Establish functional ectopic expression of uppP under control of an inducible promoter before attempting to delete the native copy, as demonstrated in the B. subtilis system where complementation with xylose-induced phosphatases rescued lethal phenotypes .

  • Address Genomic Instability: B. petrii's tendency to undergo spontaneous genomic rearrangements and lose genomic islands during laboratory culture necessitates careful strain validation throughout experiments. Regularly sequence relevant genomic regions and monitor the presence of genomic islands that might influence uppP expression or function.

  • Employ Partial Depletion Approaches: Use CRISPRi or antisense RNA technologies to achieve partial knockdown rather than complete knockout, allowing observation of synthetic growth defects rather than absolute lethality.

  • Utilize Heterologous Systems: Test potential synthetic lethality relationships by expressing B. petrii genes in model organisms like B. subtilis where UPP phosphatase synthetic lethality has been established , allowing controlled studies in a more genetically stable background.

  • Develop High-Throughput Fitness Assays: Create methods to rapidly assess bacterial fitness under conditions of UppP depletion combined with systematic inhibition of other genes, enabling identification of synthetic relationships without requiring viable double mutants.

By combining these approaches, researchers can navigate the challenges of studying essential gene interactions in B. petrii's dynamic genome context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.