KEGG: bpt:Bpet0062
STRING: 340100.Bpet0062
Bordetella petrii UPF0060 membrane protein Bpet0062 is a 110-amino acid bacterial membrane protein belonging to the UPF0060 protein family. The protein consists of a predominantly hydrophobic amino acid sequence (MPLLHTLGLFALTAVAEIVGCYLPYLWLKQGHSAWLLVPAALSLAVFAWLLTLHPTASGRVY AAYGGVYVSMALLWLWAVDGVRPATTDWAGVGLCLAGMALIMAGPRHG) that suggests multiple transmembrane domains . The protein is encoded by the Bpet0062 gene in Bordetella petrii, with UniProt ID A9HVV4 . Unlike many other Bordetella proteins, Bpet0062 has not been extensively characterized in relation to virulence factors such as the Type III Secretion System (T3SS) that are prominent in this bacterial genus .
Recombinant Bpet0062 protein production involves heterologous expression in E. coli expression systems with an N-terminal His-tag for purification purposes . The recombinant protein typically includes the full-length sequence (amino acids 1-110) of the native protein . After expression, the protein undergoes purification, likely via immobilized metal affinity chromatography (IMAC) due to the His-tag, followed by quality control measures including SDS-PAGE to confirm purity greater than 90% . The purified protein is then prepared as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability during storage .
For optimal preservation of Bpet0062's structural and functional integrity, the lyophilized protein should be stored at -20°C to -80°C upon receipt . When preparing the protein for experimental use, researchers should:
Briefly centrifuge the vial before opening to ensure all material is at the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)
Aliquot the solution to minimize freeze-thaw cycles, which can damage protein structure
Store working aliquots at 4°C for short-term use (up to one week)
Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and aggregation .
When designing experiments with Bpet0062, researchers should consider implementing either fully experimental or quasi-experimental designs depending on the research question . For structure-function relationship studies, controlled experimental designs with specific manipulations to the protein sequence and appropriate controls are recommended. Experimental designs should account for:
The membrane-bound nature of the protein, which may require detergent solubilization or reconstitution into lipid systems
The presence of the His-tag, which may influence protein behavior or require removal for certain applications
Appropriate negative controls (e.g., irrelevant membrane proteins) and positive controls
The hydrophobic character of the protein, which may affect solubility and handling
Implementation science approaches may be useful when investigating the protein's role in broader bacterial physiology contexts, potentially employing pre-post designs with non-equivalent control groups or interrupted time series analyses .
Studying protein-protein interactions for Bpet0062 requires methodological rigor due to its membrane localization. Recommended approaches include:
Co-immunoprecipitation studies: Utilizing the His-tag for pulldown assays, followed by mass spectrometry to identify interaction partners. This approach requires careful optimization of detergent conditions to maintain native-like membrane protein conformations.
Yeast two-hybrid adaptations: Modified membrane yeast two-hybrid systems can be employed, though these require specialized vectors to accommodate membrane proteins.
Cross-linking studies: Chemical cross-linking followed by mass spectrometry (XL-MS) can capture transient interactions occurring in the membrane environment.
Proximity labeling: Techniques such as BioID or APEX2 fusion proteins can identify proximal proteins in living cells.
Surface plasmon resonance: For in vitro interaction studies, though this requires careful protein reconstitution in appropriate membrane mimetics.
When reporting such studies, researchers should clearly document the experimental conditions, including detergent types and concentrations, buffer compositions, and temperature conditions that maintain protein stability and function .
While specific structural information about Bpet0062 is limited in the available literature, comparative analysis with other Bordetella membrane proteins reveals interesting distinctions. Unlike the well-characterized T3SS components in Bordetella species, such as BscC, BscD, and BscJ that form membrane-spanning ring structures of the injectisome , Bpet0062 does not appear to be associated with the secretion apparatus based on current evidence.
The T3SS proteins in Bordetella are organized into complex multiprotein assemblies with defined roles in virulence, for example:
| Protein | Location | Function in T3SS |
|---|---|---|
| BscC | Outer membrane | Forms outer membrane ring |
| BscD, BscJ | Inner membrane | Forms concentric inner membrane rings |
| BscRSTU, BcrD | Inner membrane | Forms export apparatus |
| BscK, BscQ, BscL, BscN | Cytoplasm | Forms sorting platform |
| BscF | Extracellular | Forms needle filament |
| Bsp22 | Extracellular | Forms filament tip |
In contrast, Bpet0062 belongs to the UPF0060 family, whose functions remain largely uncharacterized . The 110-amino acid length of Bpet0062 is significantly shorter than many T3SS components (e.g., BteA at 658 aa) , suggesting a distinct functional role. Research comparing expression patterns, post-translational modifications, and interaction networks between Bpet0062 and other Bordetella membrane proteins would provide valuable insights into its unique biological role.
For optimal structural prediction of Bpet0062, a multi-method approach is recommended given its classification as a membrane protein:
Transmembrane topology prediction: Programs such as TMHMM, HMMTOP, and Phobius should be employed to predict transmembrane segments. The amino acid sequence (MPLLHTLGLFALTAVAEIVGCYLPYLWLKQGHSAWLLVPAALSLAVFAWLLTLHPTASGRVY AAYGGVYVSMALLWLWAVDGVRPATTDWAGVGLCLAGMALIMAGPRHG) suggests multiple hydrophobic transmembrane regions .
Deep learning-based structure prediction: AlphaFold2 or RoseTTAFold can generate tertiary structure predictions, though these should be interpreted cautiously for membrane proteins.
Homology modeling: If structural homologs exist in the PDB, tools like SWISS-MODEL can generate comparative models, though the UPF0060 family has limited structural representatives.
Molecular dynamics simulations: To refine predictions and assess stability in membrane environments, simulations in explicit lipid bilayers are recommended.
Secondary structure prediction: Methods like PSIPRED can help identify helical regions common in transmembrane proteins.
Each prediction should be cross-validated across multiple methods, with particular attention to consensus predictions of transmembrane segments. The results should inform experimental approaches such as site-directed mutagenesis or truncation studies to verify structural elements.
Determining the precise cellular localization of Bpet0062 requires a combination of computational prediction and experimental verification. Recommended methodological approaches include:
Subcellular fractionation: Separate bacterial membrane fractions (inner vs. outer membrane) using differential centrifugation with detergent treatment, followed by Western blotting using anti-His antibodies to detect the tagged Bpet0062 protein.
Immunogold electron microscopy: Utilize gold-conjugated anti-His antibodies to visualize the localization of Bpet0062 at high resolution, distinguishing between inner and outer membrane localization.
Fluorescence microscopy: Express Bpet0062 fused to fluorescent proteins (ensuring the fusion doesn't disrupt targeting) and co-localize with known membrane markers.
Protease accessibility assays: Determine the orientation of Bpet0062 in the membrane by assessing its susceptibility to proteases in intact cells versus spheroplasts.
PhoA/GFP fusion analysis: Create translational fusions with reporters that function differently depending on their cellular localization (e.g., PhoA is active in the periplasm, while GFP functions in the cytoplasm).
The sequence characteristics of Bpet0062, particularly its hydrophobic regions, strongly suggest a membrane localization , but experimental verification is essential for definitive determination of its specific membrane distribution and orientation.
Investigating the physiological role of Bpet0062 requires a systematic approach combining genetic manipulation, phenotypic analysis, and interactome studies:
Gene deletion/knockdown studies: Create Bpet0062 deletion mutants in Bordetella petrii and assess phenotypic changes compared to wild-type strains. Implementation science approaches using quasi-experimental designs may be appropriate for analyzing complex phenotypes .
Complementation assays: Reintroduce wild-type or mutated versions of Bpet0062 into knockout strains to confirm phenotype specificity and identify critical functional residues.
Transcriptomic and proteomic profiling: Compare wild-type and Bpet0062 mutant strains under various growth conditions to identify affected pathways.
Stress response testing: Evaluate resistance to various stressors (pH, temperature, osmotic stress, antimicrobial compounds) in wild-type versus mutant strains.
Metabolomic analysis: Identify metabolic changes associated with Bpet0062 deletion.
Bacterial two-hybrid screening: Identify potential interaction partners that may provide functional clues.
Heterologous expression: Express Bpet0062 in other bacterial species to assess if it confers novel phenotypes or complements mutants of potential homologs.
The results should be integrated into a comprehensive model of Bpet0062 function, considering its potential role in membrane integrity, transport, signaling, or other membrane-associated processes.
Researchers working with recombinant Bpet0062 commonly encounter several technical challenges that require specific troubleshooting approaches:
When addressing these challenges, researchers should maintain detailed records of experimental conditions and outcomes to identify optimal protocols for their specific application of Bpet0062.
Proper analysis and interpretation of Bpet0062 functional data requires careful consideration of several methodological factors:
Statistical approaches:
Implement appropriate statistical tests based on experimental design (e.g., t-tests for simple comparisons, ANOVA for multiple conditions)
Consider using implementation science statistical methods for complex experimental designs, such as interrupted time series analysis for temporal studies
Include power calculations to ensure adequate sample sizes
Controls and normalizations:
Include negative controls (irrelevant membrane proteins) and positive controls when available
Normalize data to account for variations in protein concentration and activity
Consider using internal standards for quantitative assays
Data visualization:
Use appropriate graphical representations for different data types (bar charts for discrete comparisons, scatter plots for correlations)
Include error bars representing standard deviation or standard error
Consider using heat maps for large-scale datasets
Reproducibility considerations:
Verify results across multiple protein batches to account for preparation variability
Assess inter-lab reproducibility when possible
Document all experimental parameters thoroughly
Integration with existing knowledge:
Compare results with other UPF0060 family proteins
Consider the broader context of Bordetella membrane protein functions
Evaluate results in light of known bacterial physiological processes
Researchers should be particularly cautious about interpreting phenotypic changes, as membrane proteins often have pleiotropic effects that may complicate direct functional assignments.
Several cutting-edge technologies hold promise for elucidating the structure and function of Bpet0062:
Cryo-electron microscopy (cryo-EM): High-resolution structural determination of membrane proteins without crystallization, potentially revealing Bpet0062's native conformation in membrane environments.
Single-molecule techniques: Methods such as single-molecule FRET or atomic force microscopy can provide insights into conformational dynamics and interactions.
Native mass spectrometry: Advanced techniques for analyzing membrane proteins in near-native states to determine oligomerization states and binding partners.
Genome-wide CRISPRi screens: Systematic identification of genetic interactions involving Bpet0062 through growth phenotypes.
Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Probing structural dynamics and ligand-binding sites.
Artificial intelligence approaches: Beyond AlphaFold2, emerging AI tools may better predict membrane protein structures and functional sites.
In-cell structural biology: Techniques such as in-cell NMR or in-cell cross-linking mass spectrometry to study the protein in its native environment.
These technologies could be particularly valuable for understanding Bpet0062 in the context of Bordetella pathogenesis and potential roles distinct from the well-characterized Type III Secretion System components .
While Bpet0062 has not been directly linked to virulence mechanisms in the available literature, its research can be integrated with broader Bordetella pathogenesis studies through several approaches:
Comparative genomics: Analyze the conservation and genetic context of Bpet0062 across pathogenic and environmental Bordetella species to infer potential roles in adaptation to different niches.
Host-pathogen interaction studies: Determine if Bpet0062 influences bacterial interactions with host cells, potentially through mechanisms distinct from the established T3SS pathways .
Transcriptional regulation analysis: Investigate whether Bpet0062 expression correlates with known virulence regulons, such as the BvgAS two-component system that controls many Bordetella virulence factors.
Infection models: Assess the impact of Bpet0062 deletion on colonization and persistence in appropriate animal models.
Immunological studies: Determine if Bpet0062 elicits immune responses or contributes to immune evasion strategies.
Unlike the well-characterized T3SS effector proteins like BteA (which contains defined functional domains such as the lipid raft targeting domain and cytotoxic domain ), Bpet0062's role remains to be fully elucidated. Its study may reveal novel aspects of Bordetella biology beyond the established virulence mechanisms, potentially contributing to our understanding of the bacterium's environmental persistence or adaptation to different hosts.