Recombinant Borrelia burgdorferi Flagellar biosynthetic protein flhB (flhB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. To prevent degradation, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
flhB; BB_0272; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
flhB
Target Protein Sequence
MIKDEFLIKSWYIPLDFFSADDEGRTELPTDQKKQKAREEGRVLKSTEINTAVSLLLLFA LFFFMLSYFALDLIAVFKEQAIKLPEVMRMSVYTMGFAYIRSIMGYVVLFFFASLAVNFF VNIIQVGFFITFKSLEPRWDKISFNFSRWAKNSFFSAGAFFNLFKSLLKVVIICLIYYFI IENNIGKISKLSEYTLQSGISIVLVIAYKICFFSVMFLAIVGVFDYLFQRSQYIESLKMT KEEVKQERKEMEGDPLLRSRIKERMRVILSTNLRVAIPQADVVITNPEHFAVAIKWDSET MLAPKVLAKGQDEIALTIKKIARENNVPLMENKLLARALYANVKVNEEIPREYWEIVSKI LVRVYSITKKFN
Uniprot No.

Target Background

Function
This protein is essential for the formation of the rod structure in the basal body of the flagellar apparatus. In conjunction with FliI and FliH, it may constitute the export apparatus for flagellin.
Database Links

KEGG: bbu:BB_0272

STRING: 224326.BB_0272

Protein Families
Type III secretion exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of FlhB in Borrelia burgdorferi flagellar assembly?

FlhB functions as an essential component of the flagellar type III secretion system (T3SS) in spirochetes including B. burgdorferi. The protein plays a crucial role in the proper assembly of bacterial flagella by controlling the ordered export of flagellar proteins. In the flagellar assembly process, FlhB acts as a substrate specificity switch that regulates the transition from early to late substrate secretion. This switch mechanism ensures the correct sequential assembly of flagellar components, which is essential for proper flagellar formation and function. The importance of FlhB is highlighted in studies with other bacterial species where deletion of flhB results in complete abolishment of motility and flagella synthesis . Based on structural and functional conservation among bacterial species, B. burgdorferi FlhB likely serves similar critical functions in flagellar assembly, which is particularly important considering that spirochetes like B. burgdorferi rely on their unique periplasmic flagella for their distinctive corkscrew-like motility that enables tissue penetration during infection .

How is the FlhB protein structurally organized?

The FlhB protein consists of two primary domains: an N-terminal transmembrane domain and a C-terminal cytoplasmic domain (FlhB​C). The transmembrane domain typically contains 4-5 membrane-spanning segments that anchor the protein to the bacterial inner membrane. The cytoplasmic domain (FlhB​C) protrudes into the cytoplasm and contains the functional regions necessary for substrate recognition and export regulation. A particularly important feature in FlhB​C is the conserved NPTH sequence, which undergoes autocleavage but remains associated after cleavage. This post-translational modification is critical for the switch in substrate specificity during flagellar assembly. Circular dichroism studies of FlhB​C from Aquifex aeolicus suggest the presence of at least two cooperatively unfolding domains, which might correspond to the two fragments generated by auto-cleavage at the conserved NPTH sequence . Although the exact structure of B. burgdorferi FlhB has not been fully characterized, comparative analysis with FlhB proteins from other bacteria suggests a similar domain organization and functional architecture.

What interaction partners of FlhB are crucial for flagellar assembly?

FlhB interacts with multiple flagellar proteins to coordinate the ordered assembly of the flagellar structure. Key interaction partners likely include: (1) other components of the export apparatus such as FlhA, FliP, FliQ and FliR; (2) cytoplasmic components like FliI (the ATPase that provides energy for protein export); (3) the C-ring components FliM and FliY that are involved in rotational switching; and (4) flagellar substrate proteins that are exported through the T3SS. In studies with Listeria monocytogenes, deletion of flhB affected the expression and secretion of flagellar proteins, with complete abolishment of FlaA (flagellin) expression and reduced expression of cytoplasmic proteins FliY and FliM . These interactions demonstrate that FlhB not only serves as a physical component of the export apparatus but also influences the expression levels of other flagellar proteins. Based on the high degree of conservation in flagellar systems, B. burgdorferi FlhB likely participates in similar protein-protein interactions, though the specific binding partners may differ slightly due to variations in flagellar gene content across bacterial species.

What expression systems are most effective for producing recombinant B. burgdorferi FlhB?

For recombinant expression of B. burgdorferi FlhB, E. coli-based systems are commonly employed due to their versatility and ease of genetic manipulation. When selecting an expression system, researchers should consider several key factors. First, the toxicity of membrane proteins like full-length FlhB often necessitates the use of tightly regulated expression systems such as pET vectors with T7 promoters. Second, expression of just the cytoplasmic domain (FlhB​C) rather than the full-length protein often yields better results due to the challenges associated with membrane protein expression. Third, using fusion tags like His6, MBP, or SUMO can improve solubility and facilitate purification. The choice between BL21(DE3), C41(DE3), or C43(DE3) E. coli strains should be based on expression optimization tests, as the latter two strains are engineered specifically for membrane protein expression. Expression conditions typically require optimization of temperature (often lowered to 16-25°C after induction), IPTG concentration (typically 0.1-0.5 mM), and induction duration (4-16 hours) . Researchers working with flagellar proteins have found that eliminating native flagella in the expression host can improve recombinant protein yield by redirecting cellular energy resources, a strategy that may be beneficial for FlhB expression .

What purification strategies yield the highest purity and activity of recombinant FlhB?

Purification of recombinant FlhB requires different approaches depending on whether the full-length protein or just the cytoplasmic domain is being isolated. For the membrane-bound full-length FlhB, a detergent-based extraction is necessary. Commonly used detergents include n-dodecyl-β-D-maltopyranoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration. The purification typically follows a multi-step process: (1) cell lysis in buffer containing protease inhibitors; (2) membrane fraction isolation by ultracentrifugation; (3) solubilization of membrane proteins with detergent; (4) affinity chromatography (commonly Ni-NTA for His-tagged proteins); (5) ion exchange chromatography for further purification; and (6) size exclusion chromatography as a final polishing step. For the cytoplasmic domain (FlhB​C), purification is generally more straightforward as it doesn't require detergent extraction. Based on studies with FlhB​C from other bacteria, maintaining buffer conditions that stabilize the protein's native conformation is crucial, particularly considering that some mutations can significantly affect the stability of FlhB​C . The purified protein should be assessed for proper folding using circular dichroism spectroscopy, which can provide valuable information about secondary structure content and stability, as demonstrated in studies of FlhB​C variants from Aquifex aeolicus.

What functional assays can determine if recombinant FlhB is properly folded and active?

Several complementary approaches can assess the functionality of recombinant FlhB protein. First, circular dichroism (CD) spectroscopy can evaluate secondary structure content and thermal stability, providing a baseline indication of proper folding. The CD spectra of properly folded FlhB​C typically show characteristics of mixed α-helical and β-sheet content, which can be compared to published data for FlhB proteins from other bacteria . Second, autocleavage assays can assess whether the protein undergoes the characteristic post-translational processing at the conserved NPTH site. This can be monitored by SDS-PAGE or Western blot analysis, looking for the appearance of the two cleavage products. Third, in vitro binding assays with known interaction partners (such as FliI, FliM, or substrate proteins) can confirm functional protein-protein interactions. Finally, complementation assays, where recombinant FlhB is expressed in flhB deletion mutants, represent the gold standard for functionality assessment. Restoration of motility and flagellar assembly in these mutants would provide definitive evidence of proper folding and function. In studies with Listeria monocytogenes, complemented strains (C△flhB) showed full restoration of motility and flagella synthesis, confirming the functionality of the expressed FlhB protein .

How can structural analysis of FlhB contribute to understanding spirochete motility?

Structural analysis of FlhB can provide valuable insights into the molecular mechanisms of flagellar assembly regulation in spirochetes. X-ray crystallography, cryo-electron microscopy, and NMR spectroscopy represent powerful approaches to determine the three-dimensional structure of FlhB at atomic resolution. These structural data can reveal crucial details about the conformational changes associated with the substrate specificity switch function of FlhB. Particularly important are structural studies of the NPTH autocleavage site and its surrounding regions, which undergo significant conformational changes during the switch from early to late substrate export. Studies with Aquifex aeolicus FlhB​C have shown that certain mutations can destabilize the protein structure, suggesting that conformational flexibility is important for FlhB function . In the context of spirochetes like B. burgdorferi, structural data on FlhB could help explain how this protein contributes to the unique arrangement of periplasmic flagella that enables the distinctive corkscrew-like motility essential for tissue penetration during infection . Combining structural analysis with molecular dynamics simulations could further enhance our understanding of how FlhB coordinates with other flagellar proteins to regulate the ordered assembly of this complex molecular machine.

What are the challenges in expressing recombinant B. burgdorferi FlhB and how can they be overcome?

Recombinant expression of B. burgdorferi FlhB presents several technical challenges. The membrane-associated nature of full-length FlhB makes it difficult to express in heterologous systems due to potential toxicity, improper folding, and aggregation. Additionally, the AT-rich genome of B. burgdorferi can lead to codon usage incompatibility in common expression hosts like E. coli. To overcome these challenges, researchers can implement several strategies: (1) codon optimization of the B. burgdorferi flhB gene for expression in E. coli; (2) expression of just the cytoplasmic domain (FlhB​C) rather than the full-length protein; (3) use of fusion partners that enhance solubility such as MBP, SUMO, or Trx; (4) selection of specialized E. coli strains designed for membrane protein expression (C41/C43) or those supplying rare codons (Rosetta); and (5) careful optimization of induction conditions, typically using lower temperatures (16-20°C) and reduced inducer concentrations. For structural studies requiring isotopic labeling, minimal media formulations enriched with nitrogen and carbon sources may need further optimization. Another approach, based on studies with FlhB from Salmonella and Aquifex, involves creating chimeric proteins where the transmembrane domain from a more easily expressed species is fused to the cytoplasmic domain of B. burgdorferi FlhB . This strategy could potentially overcome expression difficulties while still providing valuable information about the function of the B. burgdorferi FlhB​C domain.

How does FlhB function differently in spirochetes compared to other flagellated bacteria?

Spirochetes like B. burgdorferi possess unique flagellar arrangements compared to externally flagellated bacteria, with periplasmic flagella that wrap around the cell cylinder between the outer membrane and cell wall. This distinctive organization likely imposes special requirements on the flagellar export apparatus, including FlhB. While the core functions of FlhB in substrate specificity switching are likely conserved, several adaptations may exist in spirochetes. First, the exact substrate recognition mechanisms might differ to accommodate spirochete-specific flagellar proteins. Second, the regulatory networks controlling FlhB expression and function may be adapted to the environmental conditions encountered by B. burgdorferi during its complex life cycle between ticks and mammalian hosts. Third, the physical constraints of assembling periplasmic flagella might necessitate specific structural adaptations in the FlhB protein. Comparative studies between FlhB proteins from diverse bacterial species have shown that while chimeric FlhB proteins (composed of domains from different species) can sometimes function, they often exhibit reduced efficiency, suggesting species-specific adaptations . In the case of B. burgdorferi, the flhB gene likely evolved specific features to support the assembly of periplasmic flagella under the unique constraints of the spirochete cell architecture and its host-pathogen lifestyle, which involves dramatic environmental transitions during transmission between arthropod vectors and mammalian hosts .

What genetic approaches are most effective for studying flhB function in B. burgdorferi?

Several genetic approaches can be employed to study flhB function in B. burgdorferi. First, gene deletion using homologous recombination represents a powerful approach to assess the effects of flhB absence on flagellar assembly, motility, and virulence. This technique typically involves replacing the flhB gene with an antibiotic resistance cassette flanked by sequences homologous to the regions surrounding the flhB gene. Second, site-directed mutagenesis can be used to create specific mutations in flhB, particularly in conserved regions like the NPTH autocleavage site or residues identified as important through structural studies. Third, complementation studies, where wild-type or mutant flhB is reintroduced into flhB deletion strains, are essential to confirm that observed phenotypes are specifically due to flhB manipulation rather than polar effects on adjacent genes. Fourth, reporter gene fusions (such as flhB-gfp) can provide valuable information about protein localization and expression patterns during different growth phases or environmental conditions. Similar approaches have been successfully applied in studies with Listeria monocytogenes, where flhB deletion mutants were constructed using homologous recombination and complemented strains were generated to restore the wild-type phenotype . When applying these techniques to B. burgdorferi, researchers should consider the additional challenges posed by this organism's unique biology, including its slow growth rate, complex nutritional requirements, and the need for specialized media and culture conditions.

What phenotypic changes occur in B. burgdorferi when flhB is mutated?

Mutations in flhB can lead to a range of phenotypic changes depending on the nature and location of the mutation. Complete deletion of flhB likely results in non-motile bacteria lacking properly assembled flagella, similar to what has been observed in other bacteria like Listeria monocytogenes . Specific mutations in the cytoplasmic domain, particularly around the NPTH autocleavage site, may lead to more subtle phenotypic changes such as altered substrate specificity, resulting in flagella with abnormal composition or structure. These structural abnormalities could manifest as changes in motility patterns, swimming speed, or the ability to navigate through viscous environments. Studies with FlhB in Salmonella and Aquifex have shown that certain suppressor mutations can partially restore motility in FlhB substitution mutants, suggesting complex structure-function relationships . In the context of B. burgdorferi, FlhB mutations could potentially affect not only motility but also virulence-related phenotypes, as flagellar motility is crucial for the spirochete's ability to disseminate within the host, penetrate tissues, and establish infection . Phenotypic analysis should include motility assays (both in liquid media and semi-solid agar), electron microscopy to visualize flagellar structures, immunoblotting to assess flagellar protein expression and secretion, and potentially animal infection models to evaluate effects on virulence.

How does flhB expression affect other flagellar genes in B. burgdorferi?

The expression of flhB likely has significant regulatory effects on other flagellar genes in B. burgdorferi. Studies in Listeria monocytogenes have shown that deletion of flhB resulted in the downregulation of transcription for multiple flagellar-associated genes, including flaA, fliM, fliY, and several others . This suggests that FlhB not only functions as a structural component of the flagellar export apparatus but also participates in regulatory feedback loops that control flagellar gene expression. In B. burgdorferi, similar regulatory networks likely exist, potentially involving interactions between FlhB and other regulatory factors specific to spirochetes. The hierarchical nature of flagellar gene expression means that disruption of flhB could have cascade effects on both early and late flagellar genes. To characterize these effects comprehensively, researchers should employ transcriptomic approaches such as RNA-seq or microarray analysis to compare gene expression profiles between wild-type and flhB mutant strains. Additionally, quantitative RT-PCR can be used to validate changes in expression for specific genes of interest. Proteomic analysis using techniques like mass spectrometry could further reveal how FlhB affects the abundance of flagellar proteins at the translational level. Understanding these regulatory relationships is crucial for developing a complete picture of how FlhB contributes to flagellar assembly and motility in B. burgdorferi.

How does FlhB contribute to B. burgdorferi pathogenesis in Lyme disease?

FlhB likely contributes significantly to B. burgdorferi pathogenesis through its essential role in flagellar assembly and subsequent motility. Motility is critical for several aspects of the B. burgdorferi infectious cycle: initial dissemination from the tick bite site, migration through host tissues, penetration of endothelial barriers, and persistent infection through evasion of immune responses. The periplasmic flagella of B. burgdorferi not only provide motility but also contribute to the distinctive morphology of the spirochete, which facilitates movement through dense tissues . As an essential component of the flagellar type III secretion system, FlhB ensures the correct assembly of these crucial structures. Without functional FlhB, B. burgdorferi would likely be non-motile or exhibit severely impaired motility, significantly reducing its invasive capabilities and pathogenic potential. Studies in mouse models of Lyme disease could compare the infectivity, dissemination, and persistence of wild-type B. burgdorferi versus strains with flhB mutations to quantify the contribution of this protein to pathogenesis. Additionally, the flagellar apparatus may play roles beyond motility, potentially contributing to adhesion to host tissues or serving as a secretion system for virulence factors, areas where FlhB function could have further impacts on pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.