Recombinant Borrelia burgdorferi Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Description

Flagellar Protein Nomenclature and Function in B. burgdorferi

Flagellar biosynthesis in B. burgdorferi involves a coordinated assembly of structural and regulatory proteins. While fliP is not explicitly mentioned in the literature, homologs like FliH, FliI, and FliD are well-documented:

ProteinRole in Flagellar AssemblyKey Findings
FliHStabilizes FliI ATPase; critical for flagellar export machineryDepletion causes truncated filaments, reduced motility, and impaired cell division .
FliIATPase driving substrate export through the secretion apparatusRequired for efficient FlaB (flagellin) export; absence leads to shorter filaments .
FliDFlagellar cap protein; regulates filament polymerizationDeletion causes FlaB degradation via HtrA protease, leading to non-motile mutants .
FlaBMajor flagellin subunit; forms the filament backboneRecombinant FlaB is used in diagnostic assays due to immunodominance .

Recombinant Flagellar Proteins in B. burgdorferi Research

Recombinant proteins are pivotal for studying flagellar assembly and developing diagnostic tools. Notable examples include:

Table 1: Recombinant Flagellar Proteins and Their Applications

ProteinExpression SystemKey Function/ApplicationReferences
FlaBE. coli (pGEX-2T)Serodiagnosis of Lyme disease; detects early-stage antibodies .
FliWE. coli/YeastFlagellar assembly factor; vaccine development target .
FliDB. burgdorferi mutantsStudied for filament polymerization defects .

Potential Overlap with fliP and Gaps in Research

The absence of fliP in the literature raises questions about its identification. Possible explanations include:

  • Nomenclature Confusion: fliP may refer to a less-studied homolog (e.g., FliP in other bacteria is part of the flagellar export apparatus, but its role in B. burgdorferi remains uncharacterized).

  • Functional Redundancy: B. burgdorferi flagellar proteins like FliH and FliI may compensate for fliP functions, reducing its evolutionary conservation.

Research Recommendations

To advance understanding of fliP:

  1. Cross-Species Homology Searches: Compare B. burgdorferi genomic data with fliP sequences from model organisms (e.g., Salmonella enterica).

  2. CRISPR Interference Studies: Knockdown/knockout experiments to assess phenotypic effects on flagellar assembly or motility.

  3. Structural Proteomics: Cryo-EM or X-ray crystallography to map interactions with known flagellar components (e.g., FliH-FliI complex ).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
fliP; BB_0275; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
fliP
Target Protein Sequence
MRKCFNFFLFFSVTSLSFAQTKSLQTTNGLNFPFLNFDSIGGSEIAFSLQLLILLTIITL SPAFLVLMTSFLRISIVLDFIRRALSLQQSPPTQIVMGLALFLTIFTMWPTFNSIYEQAY LPLKESKINFNEFYNKGIAPLRIFMYKQMSDGRHEEIRLFMSMSNYDRPKNFSEVPTHVL IAAFILHELKVAFKMGILIFLPFIVLDIIVASVLMAMGMIMLPPVMISLPFKLILFVMVD GWTLITSGLIKSFM
Uniprot No.

Target Background

Function
This protein plays a critical role in the flagellum-specific transport system.
Database Links

KEGG: bbu:BB_0275

STRING: 224326.BB_0275

Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is Borrelia burgdorferi flagellar biosynthetic protein FliP and what role does it play in flagellar assembly?

Borrelia burgdorferi flagellar biosynthetic protein FliP is a membrane protein component of the flagellar export apparatus, which is critical for the type III secretion system that assembles the bacterial flagellum. In B. burgdorferi, periplasmic flagella are essential for the spirochete's distinctive morphology and motility. FliP forms part of the core membrane export complex that facilitates the transport of flagellar proteins across the inner membrane.

Unlike BB0259, which functions as a flagellar-specific lytic transglycosylase (renamed LTase Bb) involved in creating pores in the peptidoglycan layer for hook penetration, FliP operates at an earlier stage in flagellar assembly . While BB0259 interacts with FlgJ to facilitate hook and filament assembly, FliP is part of the export machinery that transports flagellar components from the cytoplasm to the periplasmic space for subsequent assembly.

How does the structure of B. burgdorferi FliP compare to FliP proteins in other bacteria?

B. burgdorferi FliP shares structural similarities with FliP proteins from other bacteria while possessing distinctive features adapted to the unique flagellar system of spirochetes. The protein typically contains multiple transmembrane domains that anchor it within the inner membrane, forming part of the export gate complex.

Unlike model organisms such as Salmonella enterica, B. burgdorferi has periplasmic flagella with a significantly smaller rod structure (17nm vs. 30nm in E. coli) . This structural difference suggests potential adaptations in the export apparatus components, including FliP. The spirochete-specific collar rather than the rod contacts the peptidoglycan layer in B. burgdorferi, indicating possible functional adaptations in the export machinery to accommodate this distinct architecture.

What experimental approaches are most effective for studying the function of B. burgdorferi FliP in flagellar assembly?

To effectively study B. burgdorferi FliP function, researchers should consider:

  • Gene deletion and complementation: Creating ΔfliP knockout mutants and complemented strains using methodologies similar to those employed for bb0259 studies, utilizing the B. burgdorferi-E. coli shuttle vector pBSV2G for genetic manipulation .

  • Point mutation analysis: Generating site-directed mutants targeting conserved residues, similar to the E580Q and D606N mutations created for BB0259 . This allows assessment of specific amino acids' contributions to protein function.

  • Cryo-electron tomography (cryo-ET): This technique has proven invaluable for visualizing intact flagellar structures in B. burgdorferi mutants, revealing how specific proteins contribute to flagellar assembly . For FliP studies, cryo-ET can visualize defects in export apparatus assembly or downstream flagellar structures.

  • Protein-protein interaction assays: Far-western or affinity blotting assays can be employed to identify interaction partners, similar to methods used to demonstrate BB0259-FlgJ interactions . This approach can reveal FliP's interaction network within the flagellar export apparatus.

  • Temperature-dependent expression analysis: Given that some B. burgdorferi proteins show temperature-dependent expression (as seen with BB0405 ), analyzing FliP expression at different temperatures (33°C vs. 37°C) can provide insights into its regulation during the tick-mammal transition.

What are the recommended protocols for recombinant expression of B. burgdorferi FliP?

Based on experiences with other B. burgdorferi proteins, the following expression strategies are recommended for recombinant FliP:

What purification strategies are most effective for obtaining high-purity recombinant B. burgdorferi FliP?

Purification of membrane proteins like FliP requires specialized approaches:

  • Membrane extraction: Use mild detergents like n-dodecyl β-D-maltoside (DDM) or CHAPS for efficient solubilization while preserving protein structure and function.

  • Affinity chromatography: For MBP-tagged FliP, amylose resin affinity chromatography provides an effective first purification step, as demonstrated with MBP-BB0259 . For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is recommended.

  • Size exclusion chromatography: As a final polishing step, size exclusion chromatography separates aggregates and provides buffer exchange into a stabilizing formulation containing appropriate detergent concentrations.

  • Protein concentration determination: Use the Bio-Rad protein assay kit with bovine serum albumin (BSA) as the standard, consistent with methods employed for other B. burgdorferi proteins .

  • Quality control: Assess purity by SDS-PAGE with Coomassie blue staining and confirm identity by immunoblotting with specific antibodies or by mass spectrometry.

What strategies exist for improving the yield of functional recombinant B. burgdorferi FliP?

Optimizing functional FliP production may require several complementary approaches:

  • Codon optimization: B. burgdorferi has a distinct codon usage bias compared to E. coli. Codon-optimized synthetic genes can significantly improve expression levels, as demonstrated in DNA vaccine development for B. burgdorferi proteins .

  • Truncation constructs: Expressing specific domains rather than the full-length protein may improve solubility. For transmembrane proteins like FliP, expressing periplasmic or cytoplasmic domains separately might yield functional protein fragments.

  • Chaperone co-expression: Co-expressing molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can enhance proper folding and prevent aggregation.

  • Signal peptide considerations: If FliP contains a signal peptide, removing it for cytoplasmic expression may improve yield, similar to the approach used for BB0259 where residues 1-49 were omitted .

  • Detergent screening: For membrane proteins, systematic screening of different detergents and detergent concentrations is crucial for extracting functional protein.

How can mutagenesis studies of B. burgdorferi FliP contribute to understanding flagellar assembly?

Strategic mutagenesis of FliP can provide insights into flagellar assembly mechanisms:

  • Conserved residue mutations: Identify highly conserved residues across bacterial FliP proteins and create point mutations to assess their importance. This approach proved valuable for BB0259, where the E580 residue was found essential for peptidoglycan-hydrolyzing activity .

  • Domain-specific mutations: Create mutations in different predicted domains to map their functional roles in the export process.

  • Temperature-sensitive mutations: Generate temperature-sensitive alleles that function at tick temperature (23-25°C) but not at mammalian host temperature (37°C) to understand the protein's role during transmission.

  • Complementation analysis: Test whether FliP from other bacteria can complement a B. burgdorferi fliP mutant to identify spirochete-specific functional requirements.

  • Structural dynamics: Introduce cysteine residues at strategic positions for disulfide crosslinking or fluorescent labeling to study conformational changes during the export process.

What interactions have been documented between B. burgdorferi FliP and other flagellar proteins?

While specific interactions of FliP in B. burgdorferi have not been extensively documented, research on other flagellar proteins provides a framework for investigation:

  • FliP complex partners: In model bacteria, FliP interacts with FliQ, FliR, FlhB, and FlhA to form the core export gate complex. Similar interactions likely exist in B. burgdorferi and can be studied using methods like far-western blotting, which successfully identified BB0259-FlgJ interactions .

  • Export apparatus assembly: The ordered assembly of the export apparatus likely involves sequential protein-protein interactions. Techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or pull-down assays with purified components can map these interactions.

  • Substrate recognition: FliP may interact directly with flagellar proteins destined for export. Crosslinking studies combined with mass spectrometry could identify these transient interactions.

  • Integration with unique spirochete structures: B. burgdorferi has a distinctive collar structure that contacts the peptidoglycan layer . Investigating potential interactions between FliP and spirochete-specific flagellar components could reveal adaptation mechanisms.

How does temperature affect the expression and functionality of B. burgdorferi FliP?

Temperature regulation is critical for B. burgdorferi's adaptation between tick vectors and mammalian hosts:

  • Expression analysis: Comparative protein expression at different temperatures (23°C for tick, 33°C for in vitro culture, 37°C for mammalian host) can reveal temperature-dependent regulation. Research on BB0405 demonstrated significant downregulation at 37°C compared to 33°C in B. afzelii, while expression remained constant in B. burgdorferi sensu stricto .

  • Functional assessment: Temperature may affect not only expression levels but also protein functionality. Motility assays and flagellar assembly analysis at different temperatures can assess FliP function across relevant temperature ranges.

  • Structural adaptations: Temperature changes may induce conformational changes in FliP that affect its integration into the export apparatus or its substrate specificity. Circular dichroism spectroscopy at different temperatures can detect such structural transitions.

  • Regulatory mechanisms: Investigate whether temperature-dependent expression involves transcriptional, post-transcriptional, or post-translational mechanisms using RT-qPCR, RNA stability assays, and pulse-chase experiments.

What are common challenges in producing soluble recombinant B. burgdorferi FliP?

Researchers face several challenges when expressing this membrane protein:

  • Inclusion body formation: As observed with BB0259, recombinant membrane proteins often form inclusion bodies in E. coli . Strategies to address this include:

    • Lower expression temperatures (16-18°C)

    • Reduced inducer concentrations

    • Co-expression with chaperones

    • Use of larger solubility-enhancing tags like MBP

  • Membrane protein extraction: Optimizing detergent type and concentration is critical for efficient solubilization without denaturation.

  • Protein stability: FliP may be unstable once extracted from its native membrane environment. Systematic screening of stabilizing additives (glycerol, specific lipids, osmolytes) can improve stability.

  • Proteolytic degradation: Use of protease-deficient E. coli strains and inclusion of protease inhibitors during purification can minimize degradation.

  • Proper folding assessment: Developing functional assays to confirm that recombinant FliP retains native-like properties is challenging but essential for structural and functional studies.

How can researchers overcome inclusion body formation when expressing B. burgdorferi FliP?

Based on experience with other B. burgdorferi proteins, several strategies can minimize inclusion body formation:

  • Fusion protein approach: MBP fusion has successfully produced soluble BB0259 when smaller tags failed . Other solubility-enhancing tags like SUMO, Trx, or GST may also improve solubility.

  • Cell-free expression systems: In vitro translation systems supplemented with detergents or nanodiscs can directly produce membrane proteins in a soluble environment.

  • Refolding protocols: If inclusion bodies are unavoidable, develop refolding protocols using a gradual reduction of denaturants in the presence of appropriate detergents or lipids.

  • Periplasmic expression: For portions of FliP that normally reside in the periplasm, targeting expression to the E. coli periplasm may improve folding.

  • Alternative expression hosts: Consider Gram-positive hosts like Bacillus subtilis or eukaryotic systems like yeast for membrane protein expression.

How can researchers validate the proper folding of recombinant B. burgdorferi FliP?

Confirming proper folding is essential for functional and structural studies:

  • Biophysical characterization: Techniques like circular dichroism can assess secondary structure content, while fluorescence spectroscopy can probe tertiary structure.

  • Thermal stability assays: Differential scanning fluorimetry or thermal shift assays can indicate protein stability and proper folding.

  • Limited proteolysis: Well-folded proteins typically show discrete, resistant fragments upon mild proteolytic treatment, while misfolded proteins are more completely degraded.

  • Functional reconstitution: For membrane proteins like FliP, reconstitution into liposomes or nanodiscs followed by functional assays provides the strongest evidence of proper folding.

  • Antibody recognition: If conformation-specific antibodies are available, they can distinguish between properly folded and misfolded states.

How can structural studies of B. burgdorferi FliP inform development of novel anti-borrelial agents?

Structural insights into FliP could enable targeted therapeutic development:

  • Essential function targeting: As a component of the flagellar export apparatus, FliP is likely essential for B. burgdorferi motility and viability. High-resolution structures could reveal druggable pockets unique to the spirochete protein.

  • Comparative structural biology: Identifying structural differences between B. burgdorferi FliP and human proteins could enable selective targeting.

  • Structure-guided inhibitor design: Once structural data is available, virtual screening and structure-based design can identify small molecules that disrupt FliP function or its assembly into the export apparatus.

  • Allosteric regulation: Structural studies might reveal allosteric sites that could be targeted to disrupt conformational changes necessary for export function.

  • Multimeric assembly inhibition: If FliP functions as part of a multiprotein complex, targeting the protein-protein interfaces could prevent proper assembly of the export apparatus.

What is known about the role of B. burgdorferi FliP in different host environments?

Understanding FliP's role during the pathogen's life cycle provides important insights:

What comparative studies between B. burgdorferi FliP and FliP in other spirochetes have revealed?

Comparative analysis across spirochetes provides evolutionary and functional insights:

  • Conservation patterns: Sequence alignment of FliP proteins from B. burgdorferi, Treponema pallidum, and Leptospira interrogans can identify core conserved regions versus species-specific adaptations.

  • Functional conservation: Complementation studies between spirochete species can determine whether FliP function is conserved despite sequence divergence.

  • Structural adaptations: Different spirochetes inhabit distinct niches, from the mammalian bloodstream to tissue environments to arthropod vectors. These differences may be reflected in adaptations of their flagellar export systems.

  • Export substrate specificity: Different spirochetes may have evolved distinct substrate recognition properties in their export apparatus components, including FliP, to accommodate species-specific flagellar proteins.

  • Transport systems evolution: Recent studies have identified novel transport systems in B. burgdorferi, such as those related to lipopolysaccharide transport . Investigating the relationship between these systems and the flagellar export apparatus may reveal unique aspects of spirochete biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.