Recombinant Borrelia burgdorferi Motility protein A (motA)

Shipped with Ice Packs
In Stock

Description

Overview of MotA in Borrelia burgdorferi

Motility protein A (MotA) is a transmembrane component of the flagellar stator complex in Borrelia burgdorferi, the causative agent of Lyme disease. This protein, encoded by the gene motA (BB0281), forms a proton channel with MotB to generate torque for flagellar rotation, enabling the spirochete’s characteristic corkscrew motility essential for host invasion and dissemination .

Role in the Flagellar Motor

  • Stator Assembly: MotA and MotB form a proton-driven stator complex anchored to the peptidoglycan layer. The cytoplasmic domain of MotA interacts with FliG in the rotor’s C-ring to transfer torque .

  • Symmetry and Stability: Cryo-ET studies reveal that B. burgdorferi’s stator has 16-fold symmetry, with MotA forming the transmembrane proton channel .

Genetic and Biochemical Studies

  • Mutant Analyses: Deletion of motA disrupts flagellar rotation, rendering B. burgdorferi non-motile and avirulent in murine models .

  • Proton Channel Activity: MotA’s Asp24 residue (in MotB) is critical for proton flux, confirmed via mutagenesis and electrophysiological assays .

Interaction with Other Flagellar Components

ProteinFunctionInteraction with MotA
MotBPeptidoglycan-binding stator subunitForms heterotetramer (MotA₄MotB₂)
FliGRotor C-ring componentTransduces torque via cytoplasmic domain
FlcAPeriplasmic collar proteinStabilizes stator-rotor interface

Challenges and Future Directions

  • Heterologous Expression: Recombinant MotA requires refolding for functional assays due to insolubility in E. coli .

  • Drug Targeting: MotA’s essential role in motility makes it a candidate for anti-borrelial therapies, though no inhibitors are currently validated .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize developing the specified tag.
Synonyms
motA; BB_0281; Motility protein A; Chemotaxis protein MotA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
motA
Target Protein Sequence
MNLASIIGWGVGFGAILISMAFTPTGLGVFWDLSSVFITVVGSFSALMASSEVVAVKKIP TYLGFFFRRNSYAKVSIIKILVELSEKARKEGLLSLDDELEQINDPFFKSGMRLVVDGAD PEVIRTMLYLELDQMQERHKVGSDLFKTWAKLAPAFGMTGTLIGLVALLGNLEDKSALGS SMAVALITTLYGTIMANLMFTPVQLKLEKIDTEEAAVKTMIIEGVLSIQSGDNPRILEQK LMTFLTPKDRSQLNSSIGGE
Uniprot No.

Target Background

Function
MotA and MotB constitute the stator element of the flagellar motor complex. They are essential for flagellar motor rotation. MotA is likely a transmembrane proton channel.
Database Links

KEGG: bbu:BB_0281

STRING: 224326.BB_0281

Protein Families
MotA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MotA in Borrelia burgdorferi?

MotA is a critical component of the flagellar motor system in Borrelia burgdorferi, functioning as part of the stator complex alongside MotB. This complex plays an essential role in converting ion flux into mechanical torque that drives flagellar rotation and enables bacterial motility. In B. burgdorferi, each flagellar motor contains 16 stator complexes that collectively contribute to the organism's distinctive motility pattern .

The stator complex appears as a cone-shaped structure embedded in the inner membrane, with a long periplasmic linker and a round periplasmic domain associated with the collar region of the flagellar motor . This structural arrangement facilitates the mechanical work necessary for flagellar rotation, which is essential for the spirochete's ability to navigate host tissues during infection.

How does MotA interact with other flagellar proteins in B. burgdorferi?

MotA interacts primarily with MotB to form the stator complex, which together functions as the energy conversion unit of the flagellar motor. Recent cryo-electron tomography studies have revealed that each periplasmic linker of the stator complex is surrounded by a ring-like structure formed by the protein FliL . This FliL ring enhances motor function by stabilizing the stator complex in an extended, active conformation.

The supramolecular complex formed by FliL, MotA, and MotB appears to be crucial for optimal flagellar function. When MotA/MotB is recruited to the motor, FliL oligomerizes from a partial ring into a full ring, which wraps around the MotB periplasmic linkers . This structural arrangement enables continuous ion influx through the stator complex, generating higher torque for flagellar rotation.

What is the structural composition of B. burgdorferi MotA?

The structural composition of B. burgdorferi MotA has been determined through homology modeling using the Phyre2 server, with MotA from Clostridium sporogenes serving as a template (45% shared sequence identity) . This modeling approach yielded a structure with 100% confidence, indicating a high degree of structural conservation between MotA proteins across different bacterial species.

MotA is a transmembrane protein that contains multiple membrane-spanning domains forming a channel for ion translocation. When assembled with MotB, this complex forms the stator unit that anchors to the peptidoglycan layer through MotB's periplasmic domain, facilitating the conversion of ion flow into torque generation .

What are the optimal expression systems for producing recombinant B. burgdorferi MotA?

For optimal expression of recombinant B. burgdorferi MotA, researchers should consider several factors that affect membrane protein expression. E. coli-based expression systems using vectors with tightly regulated promoters (such as pET or pBAD series) often provide good results for membrane proteins. When working with MotA, it's advisable to:

  • Use E. coli strains optimized for membrane protein expression (C41/C43(DE3) or Lemo21(DE3))

  • Include fusion tags (His6, SUMO, or MBP) to facilitate purification and potentially enhance solubility

  • Optimize induction conditions with lower temperatures (16-20°C) and reduced inducer concentrations

  • Consider co-expression with MotB, as the two proteins form a functional complex and may stabilize each other

For structural studies requiring higher yields, insect cell expression systems (Sf9 or Hi5 cells) or mammalian expression systems may provide better results, particularly for capturing native conformational states of the protein.

How can researchers assess the functional activity of recombinant MotA in vitro?

Assessing the functional activity of recombinant MotA requires specialized approaches that evaluate its ability to form functional stator complexes. Methodological approaches include:

  • Reconstitution in proteoliposomes: Purified recombinant MotA and MotB can be reconstituted into liposomes to measure ion conductance using patch-clamp techniques or ion flux assays. This approach evaluates the ion channel activity of the stator complex.

  • Tethered cell assays: Complementation of ΔmotA B. burgdorferi strains with recombinant MotA, followed by microscopic observation of tethered cells to measure rotational speeds and directional switching rates.

  • FRET-based interaction assays: Fluorescently labeled MotA and partner proteins (MotB, FliL) can be used to assess proper complex formation through Förster Resonance Energy Transfer measurements.

  • Motility plate assays: While less quantitative, complementation of motility in ΔmotA mutants using recombinant protein can provide a functional readout when direct structural approaches are technically challenging.

These techniques should be accompanied by controls that include non-functional MotA mutants to validate the specificity of the observed activities.

What structural changes occur in MotA during stator complex activation?

Recent cryo-electron tomography studies have provided insights into the structural changes that occur during stator complex activation. When the stator complex is recruited to the motor, significant conformational changes take place:

  • The stator complex transitions from a compact, inactive state to an extended, active conformation

  • This conformational change appears to be stabilized by the FliL ring that wraps around the MotB periplasmic linkers

  • The extended conformation facilitates ion influx through the complex, generating the torque necessary for flagellar rotation

These findings suggest that stator complex activation involves a coordinated structural rearrangement of both MotA and MotB, with FliL playing a critical role in stabilizing the active conformation. The extended configuration likely optimizes the positioning of charged residues within the ion channel formed by MotA/MotB, enhancing ion conductance and torque generation .

What strategies can be employed to overcome expression challenges with recombinant B. burgdorferi MotA?

Membrane proteins like MotA present significant challenges for recombinant expression. Researchers can employ these strategies to overcome common obstacles:

  • Codon optimization: Adjust the codon usage of the motA gene to match the expression host, particularly for the rare codons found in B. burgdorferi genes.

  • Expression construct engineering:

    • Include stabilizing fusion partners (GFP, MBP)

    • Try various truncation constructs to identify stable domains

    • Consider chimeric constructs with homologous proteins from better-expressing organisms

  • Expression conditions optimization:

    • Test induction at different growth phases (early log, mid-log)

    • Evaluate various inducer concentrations in a gradient approach

    • Screen multiple temperatures (16°C, 20°C, 25°C, 30°C, 37°C)

    • Include specific additives (glycerol, specific detergents, or stabilizing ligands)

  • Co-expression strategies:

    • Co-express with MotB to form the native complex

    • Include molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Co-express with FliL to stabilize the extended conformation

Systematic screening of these variables using small-scale expression tests before scaling up can significantly improve yields of functional recombinant MotA.

How can researchers design mutagenesis studies to identify critical residues in MotA function?

Designing effective mutagenesis studies for MotA requires a systematic approach:

  • Structure-guided mutagenesis: Utilize the homology model of B. burgdorferi MotA (based on C. sporogenes MotA with 45% sequence identity) to identify conserved residues in predicted functional domains .

  • Alanine-scanning mutagenesis: Create a library of alanine substitutions across transmembrane regions and predicted ion-conducting pathways to systematically assess their importance.

  • Conservation-based targeting: Perform multiple sequence alignments of MotA proteins across diverse bacteria to identify highly conserved residues for targeted mutagenesis.

  • Charge-swap experiments: For residues predicted to be involved in ion conduction, perform charge reversals (e.g., Asp→Arg) to test electrostatic contributions to function.

  • Domain-swapping chimeras: Create chimeric proteins with MotA from other species to identify regions responsible for B. burgdorferi-specific functions.

Each mutant should be evaluated using complementation assays in ΔmotA B. burgdorferi strains, measuring swimming speeds, flagellar rotation rates, and in vivo localization patterns to comprehensively assess functional impacts.

What are the key considerations for designing experiments to study MotA-FliL interactions?

When investigating the interactions between MotA and FliL, researchers should consider:

  • In vivo interaction studies:

    • Bacterial two-hybrid assays with various truncation constructs

    • In situ crosslinking followed by mass spectrometry analysis

    • FRET-based approaches using fluorescent protein fusions

  • Structural characterization:

    • Cryo-electron tomography of wild-type and mutant cells to visualize the FliL-MotA interface in situ

    • Co-purification and structure determination of the complex

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Functional analyses:

    • Mutational analysis of both proteins at predicted interaction sites

    • Motility assays under different environmental conditions to assess context-dependent interactions

    • Single-molecule analysis of stator dynamics in the presence and absence of FliL

The research should account for the finding that FliL oligomerizes from a partial ring into a full ring upon recruitment of MotA/MotB to the motor, suggesting a cooperative assembly mechanism that may be crucial for motor function .

How should researchers interpret motility phenotypes in MotA mutant strains?

Interpreting motility phenotypes in MotA mutant strains requires careful consideration of multiple factors:

  • Quantitative motility measurements:

    ParameterWild-typePartial loss-of-functionComplete loss-of-function
    Swimming speed (μm/s)15-205-15<5
    Run duration (s)0.2-0.5VariableN/A
    Flex frequencyRegularIrregularAbsent
    Directional persistenceHighReducedRandom
  • Context-dependent phenotypes: Some MotA mutations may show phenotypes only under specific conditions:

    • Different viscosities (mimicking host tissues)

    • Varying pH or ionic strengths

    • Presence of specific chemoattractants or repellents

  • Secondary effects: Distinguish between direct effects on motor function versus indirect effects on:

    • Protein stability or expression levels

    • Proper complex assembly with MotB

    • Recruitment to the motor (indicated by localization patterns)

  • Compensatory mechanisms: Consider potential adaptation through:

    • Upregulation of other motility proteins

    • Modified chemotaxis signaling

    • Altered flagellar gene expression

Complete characterization should include both population-based measurements and single-cell tracking to capture the full spectrum of motility behaviors in the mutant population.

What approaches can researchers use to distinguish between assembly defects and functional defects in MotA mutants?

Distinguishing between assembly defects and functional defects in MotA mutants requires a multi-faceted approach:

  • Localization studies:

    • Fluorescent protein fusions to visualize recruitment to flagellar motors

    • Immunogold labeling for electron microscopy to confirm precise localization

    • Fractionation studies to assess membrane integration

  • Structural assessment:

    • Cryo-electron tomography to visualize motor structures in situ

    • Comparison of stator complex density and conformation between wild-type and mutants

    • Analysis of FliL ring formation as an indicator of proper stator complex assembly

  • Functional measurements:

    • Ion flux assays in reconstituted systems

    • Torque measurements at different loads

    • Rotational bias and switching frequency analysis

  • Biochemical characterization:

    • Co-immunoprecipitation with MotB and FliL

    • Blue native PAGE to assess complex formation

    • Accessibility studies using membrane-impermeable labeling reagents

A systematic comparison using these approaches can reveal whether a mutation affects the ability of MotA to assemble into the motor complex or impairs its function within a properly assembled complex.

How can researchers correlate structural data from cryo-electron tomography with functional properties of MotA?

Correlating structural data from cryo-electron tomography with functional properties of MotA requires integrating multiple experimental approaches:

  • Structure-function mapping:

    • Generate a panel of MotA mutants with defined functional defects

    • Perform cryo-electron tomography on each mutant to visualize structural changes

    • Create correlation maps between specific structural features and functional parameters

  • Dynamic structural analysis:

    • Compare structures under different conditions (pH, load, ion availability)

    • Analyze conformational states in motile versus non-motile cells

    • Capture structural transitions during motor function if possible

  • Integrated data analysis:

    • Combine structural data with biophysical measurements of motor function

    • Apply molecular dynamics simulations to predict functional consequences of observed structures

    • Use machine learning approaches to identify structural patterns associated with specific functional states

  • Validation experiments:

    • Design mutations predicted to affect specific structural features

    • Test whether functional effects match predictions from structure-function correlations

    • Use complementary structural methods (e.g., FRET, crosslinking) to validate cryo-ET findings

This integrated approach can reveal how the observed extended, active conformation of the stator complex stabilized by the FliL ring relates to ion conductance and torque generation in the flagellar motor .

What are promising approaches for studying the in vivo dynamics of MotA during B. burgdorferi infection?

Studying the in vivo dynamics of MotA during infection presents significant challenges but offers crucial insights into pathogenesis. Promising approaches include:

  • Intravital microscopy technologies:

    • Fluorescently labeled MotA variants that retain function

    • Real-time imaging in infected animal models using two-photon microscopy

    • Correlative light and electron microscopy to combine functional and structural data

  • Tissue-specific expression analysis:

    • RNA-seq from different tissues during infection to track motA expression patterns

    • Ribosome profiling to assess translation efficiency in various host environments

    • Proteomics approaches to quantify MotA protein levels during infection stages

  • Conditional mutant strategies:

    • Inducible motA expression systems to manipulate motility at different infection stages

    • Temperature-sensitive motA alleles to create temporal control of function

    • Tissue-specific activation/inactivation using environmental sensing promoters

  • In vivo crosslinking approaches:

    • Photo-activatable amino acid incorporation into MotA

    • In vivo crosslinking during infection followed by mass spectrometry

    • Identification of host factors that interact with MotA during infection

These approaches could reveal how MotA function and dynamics contribute to B. burgdorferi's ability to disseminate and invade host tissues at different stages of infection .

How might researchers explore the potential of MotA as a therapeutic target for Lyme disease?

While avoiding commercial aspects, academic researchers might explore MotA as a therapeutic target through these approaches:

  • Target validation studies:

    • Assess whether motA-deficient strains show attenuated virulence in animal models

    • Determine if chemical inhibition of MotA function reduces bacterial burden in tissues

    • Evaluate whether anti-MotA antibodies affect B. burgdorferi dissemination in vivo

  • Structure-based inhibitor design:

    • Use the homology model of B. burgdorferi MotA to identify potential binding pockets

    • Conduct virtual screening of compound libraries against these pockets

    • Design peptide inhibitors that disrupt critical protein-protein interactions

  • Functional screening assays:

    • Develop high-throughput motility assays to screen for MotA inhibitors

    • Create reporter systems that monitor stator complex assembly

    • Establish ion conductance assays using reconstituted MotA/MotB complexes

  • Specificity assessment:

    • Compare MotA sequences across bacterial species to identify B. burgdorferi-specific regions

    • Evaluate cross-reactivity of potential inhibitors against human proteins

    • Test effects on commensal bacteria with similar motility systems

These academic research approaches could provide foundational knowledge for understanding whether MotA represents a viable therapeutic target while maintaining focus on the basic science rather than drug development aspects.

What computational approaches can advance our understanding of MotA function in B. burgdorferi?

Advanced computational approaches offer powerful tools for understanding MotA function:

  • Molecular dynamics simulations:

    • All-atom simulations of the MotA/MotB complex in membrane environments

    • Analysis of ion permeation pathways and gating mechanisms

    • Investigation of conformational changes during the mechanochemical cycle

  • Coarse-grained modeling:

    • Simulations of the entire flagellar motor including multiple stator units

    • Models of stator unit recruitment and turnover during motor function

    • Prediction of torque generation mechanisms

  • Network analysis approaches:

    • Identification of allosteric networks within the MotA structure

    • Prediction of how mutations propagate effects through the protein structure

    • Modeling of information transfer between the stator and rotor components

  • Machine learning applications:

    • Pattern recognition in sequence-structure-function relationships

    • Prediction of critical residues based on evolutionary conservation patterns

    • Automated analysis of motility phenotypes from microscopy data

  • Systems biology modeling:

    • Integration of MotA function into whole-cell models of B. burgdorferi motility

    • Prediction of emergent behaviors from molecular-level properties

    • Simulation of population-level responses to environmental changes

These computational approaches can generate testable hypotheses about MotA function and guide experimental design for efficient exploration of this complex molecular machine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.