Recombinant Borrelia burgdorferi Probable protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
secG; BB_0054; Probable protein-export membrane protein SecG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
secG
Target Protein Sequence
MDLVRFFIFIIFVIVSIFIILLVLIQDEQGDGIGGVFGGGSSSIFGAKSSSVAVKITGFF IALFFIFVVLLSFLNTRRADDSFLNDIKTENKNSSTFWDDENSESDANINEIKENNLKEK
Uniprot No.

Target Background

Function

Involved in protein export. Participates in an early event of protein translocation.

Database Links

KEGG: bbu:BB_0054

STRING: 224326.BB_0054

Protein Families
SecG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of SecG in Borrelia burgdorferi pathogenesis?

SecG functions as a probable protein-export membrane protein in B. burgdorferi, likely playing a role in the secretion mechanism that allows the spirochete to export virulence factors. As B. burgdorferi can spread throughout multiple body systems including the skin, heart, joints, and nervous system during infection, protein secretion mechanisms are essential for bacterial survival and pathogenesis . The protein export machinery is particularly important for B. burgdorferi as it transitions between tick vector and mammalian host environments, requiring rapid adaptation through coordinated gene expression .

How does SecG compare to other membrane proteins in B. burgdorferi?

Unlike complement regulator-acquiring surface proteins (CRASPs) such as CRASP-2, which primarily interact with host immune regulators like Factor H and FHL-1 to protect against complement-mediated lysis , SecG is involved in protein translocation across the membrane. While CRASP proteins are predominantly expressed by serum-resistant strains and directly interface with host immune components, SecG functions in the fundamental cellular process of protein export, potentially affecting the localization of multiple virulence factors. This distinction highlights the diverse roles membrane proteins play in B. burgdorferi survival strategies.

Is SecG expression regulated by environmental conditions similar to other B. burgdorferi proteins?

Like many B. burgdorferi proteins, SecG expression is likely influenced by environmental conditions that mimic different stages of the enzootic lifecycle. Studies of other B. burgdorferi genes show significant expression changes between conditions simulating unfed ticks (23°C) versus mammalian hosts (37°C) . For example, the global regulator BadR shows differential expression between these conditions, with approximately 79 genes differentially expressed when spirochetes are grown at 23°C compared to 37°C . Researchers should consider examining SecG expression under various temperature conditions to understand its regulation patterns.

What are the optimal experimental conditions for studying SecG expression in B. burgdorferi?

When designing experiments to study SecG expression, researchers should consider multiple growth conditions that reflect the bacterium's natural lifecycle. Based on established protocols for other B. burgdorferi proteins, the following experimental conditions are recommended:

Growth ConditionTemperatureMediumGrowth PhaseRelevance
Unfed tick simulation23°CBSK-glycerolMid-logarithmicMimics quiescent state in unfed ticks
Fed tick/Early mammalian infection37°CBSK-IIMid-logarithmicSimulates initial mammalian infection
Established mammalian infection37°CBSK-IIStationaryRepresents established infection state

What are the most effective methods for isolating and purifying recombinant SecG protein?

For isolating and purifying recombinant SecG protein, a fusion-tag approach similar to that used for other B. burgdorferi proteins is recommended. Based on successful protocols for CRASP-2 , researchers should consider:

  • Cloning the secG gene into an expression vector with an MBP-tag or His-tag

  • Expressing the recombinant protein in E. coli expression systems

  • Purifying using affinity chromatography to achieve >90% purity

  • Storing in appropriate buffer conditions (e.g., 0.02 M Potassium Phosphate, 0.15 M Sodium Chloride, pH 7.2)

The challenge with membrane proteins like SecG is maintaining proper folding and function after extraction from the membrane environment. Consider using mild detergents during purification and validate protein functionality through activity assays post-purification.

How should researchers design experiments to study the interaction between SecG and other components of the protein export machinery?

When investigating SecG interactions with other protein export components, implement a multi-method approach:

  • Co-immunoprecipitation assays to identify protein-protein interactions

  • Bacterial two-hybrid systems to verify direct interactions

  • Fluorescence resonance energy transfer (FRET) for in vivo interaction studies

  • Liposome reconstitution assays to examine functionality in a membrane environment

These methods should be implemented systematically, beginning with controlled in vitro systems before progressing to more complex in vivo models. Each experimental approach should include appropriate positive and negative controls to validate the specificity of observed interactions .

What techniques are most effective for analyzing the structure-function relationship of SecG in B. burgdorferi?

Advanced structural analysis of SecG requires a combination of computational and experimental approaches:

  • Homology modeling based on SecG structures from model organisms

  • Site-directed mutagenesis of conserved residues to identify functional domains

  • Circular dichroism spectroscopy to analyze secondary structure elements

  • X-ray crystallography or cryo-electron microscopy for high-resolution structural analysis

These techniques should be complemented by functional assays measuring protein translocation efficiency to correlate structural features with functional outcomes. Given that B. burgdorferi proteins often have unique structural adaptations for tick-mammal transitions, researchers should be cautious about relying solely on homology to characterized proteins from other bacterial species .

How can RNA-sequencing be optimized to study SecG regulation in the context of the B. burgdorferi transcriptome?

RNA-sequencing approaches similar to those used for studying the BadR regulon can be adapted for investigating SecG regulation. Key considerations include:

  • Sample collection at multiple growth phases (mid-logarithmic and stationary) to capture growth-dependent regulation

  • Comparison of multiple environmental conditions (23°C vs. 37°C) to model different host environments

  • Use of isogenic mutants (e.g., ΔbadR, ΔrpoS) to understand regulatory network influences

  • Implementation of appropriate normalization strategies and statistical analyses for differential expression

A comprehensive approach would involve analyzing transcriptional changes across the entire B. burgdorferi genome under conditions where SecG expression is manipulated, allowing for the identification of co-regulated genes and potential regulatory networks .

What are the methodological considerations for investigating SecG's role in B. burgdorferi virulence using animal models?

When designing in vivo experiments to study SecG's contribution to virulence:

  • Develop and validate secG knockout and complemented strains

  • Confirm in vitro phenotypes before proceeding to animal studies

  • Employ both tick-feeding models and direct inoculation of mammals to assess the role across the transmission cycle

  • Use quantitative PCR and immunohistochemistry to track bacterial dissemination and SecG expression in different tissues

Researchers must carefully control for variations in infectious dose, animal genetics, and environmental factors that could confound results. Additionally, consider the ethical implications and use appropriate statistical power calculations to minimize animal usage while ensuring scientific validity .

How should researchers address contradictory findings regarding SecG function in different B. burgdorferi strains?

When confronting contradictory data across different B. burgdorferi strains:

  • Systematically catalog strain differences, including genetic variations in secG and related genes

  • Perform comparative genomic analyses to identify strain-specific genetic contexts

  • Design experiments that directly compare multiple strains under identical conditions

  • Consider epistatic interactions that might influence SecG function in different genetic backgrounds

Recent studies on B. burgdorferi have revealed strain-specific differences in gene regulation patterns . For example, the B31 strain (ATCC 35210) is commonly used as a reference, but researchers should be aware that findings may not generalize across all B. burgdorferi sensu lato genospecies, which show considerable genetic diversity .

What statistical approaches are most appropriate for analyzing SecG expression data across different experimental conditions?

For robust statistical analysis of SecG expression data:

  • Employ appropriate normalization techniques using housekeeping genes (e.g., flaB)

  • Utilize mixed-effects models to account for batch effects and biological replication

  • Apply multiple testing corrections (e.g., Benjamini-Hochberg) when analyzing genome-wide datasets

  • Validate key findings using alternative methodologies (e.g., qRT-PCR validation of RNA-seq results)

When analyzing expression across multiple conditions, consider factorial design approaches that can reveal interaction effects between variables such as temperature, growth phase, and genetic background .

How might SecG research contribute to understanding B. burgdorferi persistence in chronic infections?

SecG research could illuminate mechanisms of bacterial persistence by:

  • Examining SecG-dependent protein export during different phases of infection

  • Investigating whether SecG function is altered during antibiotic exposure

  • Determining if SecG contributes to the formation of persister cell populations

  • Exploring potential SecG-mediated adaptations to host immune responses

Understanding SecG's role in protein translocation may provide insights into how B. burgdorferi modifies its surface proteome during long-term infections, potentially explaining the bacteria's ability to evade host immune responses and antibiotic treatments in some cases .

What emerging technologies might advance our understanding of SecG function in B. burgdorferi?

Several cutting-edge approaches show promise for SecG research:

  • CRISPR interference (CRISPRi) for conditional knockdown of secG expression

  • Single-cell RNA-sequencing to examine heterogeneity in SecG expression within bacterial populations

  • Proximity labeling techniques (e.g., BioID) to identify interaction partners in their native environment

  • Cryo-electron tomography to visualize SecG within the context of the bacterial membrane

These technologies could overcome current limitations in studying membrane proteins in B. burgdorferi, particularly challenges related to genetic manipulation and visualization of protein complexes in their native state .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.