Recombinant Borrelia burgdorferi Protein HflK (hflK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
hflK; BB_0203; Protein HflK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
hflK
Target Protein Sequence
MFDIKQIFNKTYEYLIIIITLILISIIVIANIFIVGPSEEAIVLRLGKLNRTLDSGIHVK IPLIEEKFIVPVKIVQEIKFGFLISPSDIRENDNANDESRIITGDLNIINIEWLVQYKIR DPYSFKFKVEDPETTIKDIAKSSMNRLIGDNTIFEIINDNRVGITEGVKSSMNEIIDNYN LGIDVVQVQIRNALPPKGKVYEAFEDVNIAIQDKNKYINEGRKEFNQIVPKIKGEALKVI EEARGYKESRINNALADTEIFNAILDAYLKNPDITKERLYNETMKEILENKDNIELIDKN FKNFLPFKEVK
Uniprot No.

Target Background

Function
HflC and HflK are proteins that may encode or regulate a protease.
Gene References Into Functions
  1. The absence of HflK and HflC, two potential FtsH activity modulators, does not significantly impact B. burgdorferi viability. PMID: 27094329
Database Links

KEGG: bbu:BB_0203

STRING: 224326.BB_0203

Protein Families
Band 7/mec-2 family, HflK subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the complete amino acid sequence of B. burgdorferi HflK protein?

The full-length B. burgdorferi HflK protein (UniProt ID: O51221) consists of 311 amino acids with the following sequence:
MFDIKQIFNKTYEYLIIIITLILISIIVIANIFIVGPSEEAIVLRLGKLNRTLDSGIHVKIPLIEEKFIVPVKIVQEIKFGFLISPSDIRENDNANDESRIITGDLNIINIEWLVQYKIRDPYSFKFKVEDPETTIKDIAKSSMNRLIGDNTIFEIINDNRVGITEGVKSSMNEIIDNYNLGIDVVQVQIRNALPPKGKVYEAFEDVNIAIQDKNKYINEGRKEFNQIVPKIKGEALKVIEEARGYKESRINNALADTEIFNAILDAYLKNPDITKERLYNETMKEILENKDNIELIDKNFKNFLPFKEVK

What is the predicted cellular localization of HflK in B. burgdorferi and how does this affect experimental design?

Based on the amino acid sequence analysis, B. burgdorferi HflK contains hydrophobic regions at the N-terminus suggesting membrane association. Recent spatial analyses of the B. burgdorferi proteome indicate a compartmentalization bias for many regulatory proteins toward the bacterial surface . When designing experiments, researchers should consider this membrane association by including appropriate detergents during extraction procedures. Cellular fractionation techniques should be employed to verify localization, and fusion protein constructs should be designed to maintain the protein's native topology.

How does B. burgdorferi HflK compare structurally to HflK proteins in other bacterial species?

The B. burgdorferi HflK protein shows some structural divergence from well-characterized HflK proteins in model organisms like E. coli. While maintaining key functional domains, the spirochete version has evolved specific adaptations. Unlike E. coli HflK, which functions primarily in phage lysogeny decisions, the B. burgdorferi homolog may have adapted to functions specific to the spirochete's unique enzootic cycle between arthropod vectors and vertebrate hosts, similar to adaptations seen with other regulatory proteins in this organism . Structural modeling suggests conservation of protein-protein interaction domains, though experimental validation is required.

What expression systems yield optimal production of recombinant B. burgdorferi HflK protein?

E. coli-based expression systems have been successfully used to produce recombinant B. burgdorferi HflK protein with N-terminal His-tags . For optimal expression, consider the following protocol parameters:

  • Vector selection: pET-based vectors with T7 promoter systems offer tight regulation and high expression yields

  • E. coli strain: BL21(DE3) or Rosetta strains address codon bias issues that may occur with spirochete proteins

  • Induction conditions: IPTG concentrations of 0.5-1.0 mM at lower temperatures (16-25°C) for 4-16 hours maximize soluble protein yield

  • Media supplementation: Addition of 2% glucose in pre-induction culture helps reduce basal expression and toxicity

These recommendations derive from successful expression patterns observed with other B. burgdorferi membrane-associated regulatory proteins .

What are the optimal purification strategies for recombinant His-tagged HflK protein from B. burgdorferi?

A multi-step purification strategy is recommended for high-purity HflK protein:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradient elution (50-250 mM)

  • Secondary purification: Size exclusion chromatography to separate monomeric from aggregated forms and remove contaminating proteins

  • Buffer optimization: Final protein should be stored in Tris/PBS-based buffer at pH 8.0 with 6% trehalose as a stabilizing agent

  • Quality control: SDS-PAGE analysis should confirm >90% purity with expected molecular weight of approximately 35-36 kDa (including His-tag)

Final preparations should be aliquoted to avoid freeze-thaw cycles, with recommended storage at -20°C to -80°C for long-term stability .

How can recombinant HflK be used to investigate regulatory networks in B. burgdorferi?

Recombinant HflK can serve as a valuable tool for investigating B. burgdorferi regulatory networks through the following approaches:

  • Protein-protein interaction studies: Pull-down assays using His-tagged HflK as bait to identify interaction partners within regulatory networks similar to methods used for characterizing RpoS pathway components

  • Regulatory complex reconstitution: In vitro assembly of potential HflK-containing complexes to assess functional activities

  • Comparative analysis: Examination of HflK interactions with components of established regulatory networks like the BosR/Rrp2/RpoN/RpoS pathway

  • Temporal expression correlation: Analysis of HflK expression patterns in relation to other regulatory factors during different phases of the enzootic cycle

These approaches may reveal whether HflK functions within known regulatory circuits or represents a distinct regulatory mechanism in B. burgdorferi.

What methodologies are recommended for investigating HflK's potential role in B. burgdorferi stress response?

To investigate HflK's role in stress response, researchers should consider:

  • Conditional expression systems: Creating strains with inducible HflK expression to analyze phenotypic changes under various stress conditions

  • Proteomic profiling: Comparative proteomics of wild-type versus HflK mutant strains under different stress conditions (temperature shifts, pH changes, nutrient limitation)

  • Transcriptional analysis: RNA-seq or qRT-PCR to analyze gene expression changes dependent on HflK status, using methodologies similar to those employed for other regulatory factors

  • Stress survival assays: Quantitative assessment of bacterial survival following exposure to relevant stressors (oxidative stress, temperature shifts, antimicrobial peptides)

Data interpretation should account for potential pleiotropic effects, as seen with other regulatory protein mutants like the Hfq RNA chaperone mutant, which shows increased cell length and decreased growth rate .

How can researchers design definitive experiments to establish HflK's role in B. burgdorferi pathogenesis?

Establishing HflK's role in pathogenesis requires a multi-faceted approach:

  • Murine infection studies: Generation of hflK null mutants and complemented strains for infectivity assessment in C3H/HeJ mice, measuring bacterial loads in tissues at multiple time points post-infection (2-12 weeks)

  • Tick transmission experiments: Analysis of mutant strain survival and replication during the tick blood meal and subsequent transmission to naive mice

  • Trans-complementation: Creation of strains expressing wild-type HflK from a plasmid in the hflK mutant background to confirm phenotype restoration

  • Host cell interaction assays: Quantification of HflK mutant attachment to relevant cell types (e.g., HUVECs, neuronal cells) using microscopy-based counting methods (bacteria per 100 cells)

Results should be interpreted in context of established virulence regulators like RpoS, which has demonstrated roles in transmission and mammalian infection .

What approaches can determine if HflK interacts with host factors during infection?

To investigate potential HflK-host factor interactions:

  • Affinity purification-mass spectrometry: Using recombinant HflK as bait with mammalian cell lysates to identify potential binding partners

  • Yeast two-hybrid screening: Screening against mammalian cDNA libraries to identify potential protein-protein interactions

  • Surface plasmon resonance: Measuring binding kinetics between purified HflK and candidate host molecules

  • Far-Western blotting: Probing mammalian protein arrays with labeled recombinant HflK

This approach has precedent in B. burgdorferi research, where other surface-exposed proteins like GroEL have been demonstrated to have immunogenic properties and interact with host plasminogen, facilitating bacterial dissemination .

What are common challenges in working with recombinant B. burgdorferi HflK and their solutions?

ChallengePotential CausesRecommended Solutions
Poor expression yieldCodon bias, protein toxicityUse Rosetta strains, reduce induction temperature to 16°C, add glucose to pre-induction media
Protein insolubilityImproper folding, hydrophobic regionsInclude mild detergents (0.1% Triton X-100), express as fusion with solubility tags (MBP, SUMO)
Loss of activity after purificationImproper buffer conditions, aggregationInclude stabilizers (trehalose, glycerol), optimize pH and salt concentration
Non-specific binding in interaction studiesHydrophobic patches, improper blockingIncrease blocking agent concentration, include competitors like BSA, validate with multiple controls

How can researchers verify that recombinant HflK retains native conformation and activity?

Validation of properly folded recombinant HflK should include:

  • Circular dichroism spectroscopy: To confirm secondary structure elements match theoretical predictions

  • Size exclusion chromatography: To verify oligomeric state matches expected native form

  • Functional assays: Development of activity assays based on predicted functions (e.g., protease regulation)

  • Immunological cross-reactivity: Confirming that antibodies raised against recombinant protein recognize native HflK in B. burgdorferi lysates

These quality control measures ensure that experimental findings with recombinant protein accurately reflect the native protein's biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.