Recombinant Borrelia burgdorferi Uncharacterized membrane protein BB_D15 (BB_D15)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Borrelia burgdorferi Uncharacterized Membrane Protein BB_D15 (BB0405)

Borrelia burgdorferi, the bacterium that causes Lyme disease, has a limited number of transmembrane surface proteins, many of which are key targets for immune responses . BB0405, also known as Recombinant Borrelia burgdorferi Uncharacterized membrane protein BB_D15, is a conserved membrane-spanning protein with an unknown function . Despite being exposed on the cell surface, BB0405 does not trigger a detectable antibody response during natural infection .

Gene and Protein Structure

BB0405 has two recognizable transmembrane motifs and an 18-amino acid hydrophobic N-terminal leader sequence . The bb0405 gene is part of an operon, sharing a single transcript with bb0404 and bb0406, which encode three conserved hypothetical proteins of unknown biological significance .

Expression and Localization

BB0405 is consistently transcribed in vivo during both tick- and mammal-specific phases of B. burgdorferi infection . The protein is associated with the spirochete membrane and exposed extracellularly, as shown by its sensitivity to proteinase K treatment . Antibodies against the B31 isolate of BB0405 react with BB0405 orthologs in other infectious isolates, indicating its wide conservation across diverse B. burgdorferi sensu lato .

Role in Virulence and Infectivity

Studies using targeted deletion mutants have shown that BB0405 is essential for B. burgdorferi to transmit from ticks to mammalian hosts and establish infection . Mutants lacking bb0405 exhibit a significantly slower growth rate in vitro .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
BB_D15; CdsK; Uncharacterized membrane protein BB_D15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
BB_D15
Target Protein Sequence
MLNFKFLKCVYLCFMVFVRLILIIKFRGKKFMNRKFVISLLFIILTFLLILGCDLSINND RNKIDGASHFKKKYMDNLNYQCLSKKESEAKNSQIKLDENNNKNHFYSSRVSNVSNYYDR THISCKKND
Uniprot No.

Target Background

Database Links

KEGG: bbu:BB_D15

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Borrelia burgdorferi BB_D15 protein and why is it significant for research?

BB_D15 is an uncharacterized membrane protein found in Borrelia burgdorferi, one of the major spirochete species responsible for causing Lyme disease. As a membrane protein, BB_D15 is part of a critical class of proteins that comprise approximately one-third of all proteins and are essential for numerous cellular functions . The significance of BB_D15 stems from its potential role in pathogenesis and bacterial survival, making it a valuable target for both basic research and potential therapeutic development.

Membrane proteins like BB_D15 are generally undercharacterized compared to soluble proteins, which significantly impairs our understanding of their functions and mechanisms . Borrelia burgdorferi is one of twelve known Borrelia species capable of causing human disease, and understanding its membrane proteins is crucial for advancing our knowledge of spirochete biology and host-pathogen interactions .

How should researchers approach the isolation and purification of recombinant BB_D15?

Isolation and purification of recombinant BB_D15 requires careful methodological planning due to the challenges associated with membrane proteins. The approach typically involves:

  • Expression system selection: Recombinant BB_D15 can be produced in various systems including E. coli, yeast, baculovirus, or mammalian cells . Each system offers different advantages:

    • E. coli: Higher yield but potential folding issues

    • Yeast: Better for eukaryotic-like post-translational modifications

    • Baculovirus: Improved folding for complex proteins

    • Mammalian cells: Most authentic modifications but lower yield

  • Optimization of solubilization conditions: Since membrane proteins are embedded in lipid bilayers, researchers must identify appropriate detergents or lipid nanodisc systems to maintain protein stability during purification.

  • Purification strategy: Typically involving affinity chromatography followed by size exclusion chromatography to achieve high purity.

The methodological approach must be customized based on the specific research objectives, such as structural studies versus functional assays, as each may require different levels of protein purity and native conformation preservation.

What experimental controls should be included when working with recombinant BB_D15?

Proper experimental controls are essential for ensuring valid and reliable results when working with recombinant BB_D15:

Control TypePurposeImplementation
Negative ControlsEstablish baseline and detect false positivesUse empty vector expressions, unrelated membrane proteins, or buffer-only conditions
Positive ControlsValidate experimental proceduresInclude well-characterized membrane proteins with known properties
Technical ReplicatesAssess methodology precisionPerform at least three independent expressions and purifications
Biological ReplicatesAccount for biological variabilityUse different batches of expression hosts
Expression System ControlsEvaluate system-specific effectsCompare protein from different expression systems when possible

Additionally, researchers should perform quality control assays to verify protein identity (western blot, mass spectrometry), purity (SDS-PAGE), and proper folding (circular dichroism) before proceeding with functional or structural studies .

What experimental designs are most appropriate for studying the function of BB_D15?

When designing experiments to investigate BB_D15 function, researchers should select designs that maximize validity while controlling for confounding variables. Based on experimental design principles, several approaches are suitable:

  • Completely Randomized Design (CRD): Appropriate for initial screening experiments where treatments (e.g., different conditions affecting BB_D15 function) are randomly assigned to experimental units . This design is flexible and allows for unequal replication across treatments based on preliminary knowledge.

  • Randomized Block Design (RBD): Preferable when a known source of variation exists (e.g., different protein batches). By blocking this variation, researchers can increase precision in detecting treatment effects on BB_D15 .

  • Latin Square Design (LSD): Useful when controlling for two sources of variation simultaneously (e.g., protein batch and temperature) while studying a third factor's effect on BB_D15 function .

When planning experiments, researchers should consider:

  • The research objective (exploratory vs. confirmatory)

  • Required statistical power

  • Available resources and time constraints

  • Sources of variability in membrane protein experiments

For studying interaction partners of BB_D15, mixed-method approaches combining quantitative binding assays with qualitative structural analyses may provide the most comprehensive insights .

How should quantitative versus qualitative methodologies be balanced in BB_D15 research?

Effective BB_D15 research requires thoughtful integration of both quantitative and qualitative methodologies:

Quantitative approaches are essential for:

  • Measuring binding affinities and kinetics

  • Assessing protein stability under varying conditions

  • Quantifying expression levels in different systems

  • Statistical comparisons between experimental conditions

These approaches provide concrete measurements and allow for hypothesis testing through statistical analysis methods such as descriptive analysis (mean, median, frequency) and inferential analysis (correlation, regression, variance analysis) .

Qualitative approaches contribute through:

  • Structural characterization (crystallography, cryo-EM)

  • Visualization of cellular localization

  • Analysis of conformational changes

  • Exploration of interaction networks

A mixed-method approach provides complementary perspectives, creating a richer understanding of BB_D15 properties . For example, quantitative binding assays might identify potential interaction partners, while qualitative structural studies could reveal the molecular basis for these interactions.

The balance between these methodologies should be determined by:

  • The specific research questions

  • The stage of knowledge about BB_D15

  • Available technological resources

  • The needs of the target audience for the research

What factors should be considered when designing membrane protein isolation protocols specifically for BB_D15?

When designing isolation protocols for BB_D15, researchers should consider several critical factors that affect membrane protein isolation success:

  • Protein stability factors:

    • pH range tolerance

    • Temperature sensitivity

    • Detergent compatibility

    • Buffer composition requirements

    • Protease susceptibility

  • Experimental variables to optimize:

    • Cell disruption method (sonication, French press, enzymatic lysis)

    • Membrane fraction isolation technique

    • Solubilization conditions

    • Purification strategy (single-step vs. multi-step)

    • Storage conditions

  • Quality assessment metrics:

    • Purity benchmarks

    • Activity preservation

    • Conformational integrity

    • Yield requirements

    • Batch-to-batch consistency

The experimental design should include systematic optimization of these variables, potentially using factorial designs to identify interaction effects between factors . For example, a 2×2×2 factorial design might examine the effects of temperature, detergent type, and pH on BB_D15 yield and activity simultaneously.

Which techniques are most effective for structural analysis of BB_D15?

Structural characterization of membrane proteins like BB_D15 requires specialized techniques that accommodate their amphipathic nature. The most effective approaches include:

  • X-ray crystallography: Provides atomic-level resolution but requires formation of well-ordered crystals, which is challenging for membrane proteins. Success often depends on:

    • Finding stabilizing detergents or lipid systems

    • Identifying crystallization conditions

    • Potentially using antibody fragments to facilitate crystal contacts

  • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane protein structure determination without crystallization:

    • Works well for larger membrane protein complexes

    • Can capture multiple conformational states

    • Requires less protein than crystallography

    • Resolution continues to improve with technological advances

  • Nuclear Magnetic Resonance (NMR): Valuable for dynamics studies:

    • Best for smaller domains of BB_D15

    • Can provide information in solution state

    • Allows study of protein-ligand interactions

  • Computational approaches:

    • Homology modeling if structural homologs exist

    • Molecular dynamics simulations to study conformational changes

    • Integration with experimental data for hybrid approaches

The choice of method should be guided by the specific research questions, available resources, and the physicochemical properties of BB_D15. Often, combining multiple techniques provides complementary structural insights .

How can researchers effectively present and analyze data from BB_D15 functional studies?

Effective presentation and analysis of BB_D15 functional data requires careful consideration of both format and content:

  • Data presentation principles:

    • Keep it simple to avoid obscuring key findings

    • Present general information before specific details

    • Ensure data directly answers the research questions

    • Use past tense consistently when describing results

    • Combine text, tables, and figures strategically

  • Recommended presentation formats for different data types:

Data TypeRecommended FormatAdvantages
Binding kineticsLine graphs with fitted curvesVisualizes rate constants and equilibrium values
Activity comparisonsBar charts with error barsFacilitates statistical comparisons between conditions
Structural featuresMolecular visualization figuresHighlights key structural elements and interactions
Multiple variable correlationsHeat maps or 3D surface plotsReveals patterns across multiple experimental conditions
  • Statistical analysis approaches:

    • Descriptive statistics to summarize data characteristics

    • Inferential statistics to test hypotheses about BB_D15 function

    • Multiple comparison corrections when testing several conditions

    • Effect size calculations to determine biological significance

  • Integration of qualitative and quantitative data:

    • Use qualitative structural data to explain quantitative functional findings

    • Support mechanistic hypotheses with both data types

    • Present qualitative data through visual representations and quantitative data through statistical analyses

What data analysis methods are most appropriate for addressing contradictory findings in BB_D15 studies?

When faced with contradictory findings in BB_D15 research, researchers should employ systematic data analysis approaches:

  • Meta-analytical techniques:

    • Systematically compare methodological differences across studies

    • Assess statistical power in conflicting studies

    • Evaluate effect sizes rather than just p-values

    • Consider random-effects models to account for between-study heterogeneity

  • Root cause analysis framework:

    • Examine differences in protein preparation methods

    • Compare experimental conditions (pH, temperature, buffer composition)

    • Assess differences in analytical techniques

    • Consider biological variability factors

  • Reconciliation strategies:

    • Design experiments that directly test competing hypotheses

    • Implement orthogonal methods to validate findings

    • Perform sensitivity analyses to identify condition-dependent effects

    • Consider contextual factors (e.g., strain differences, domain-specific effects)

  • Advanced statistical approaches:

    • Bayesian analysis to incorporate prior knowledge

    • Multivariate analysis to identify patterns across complex datasets

    • Machine learning for identifying non-obvious correlations in large datasets

    • Structural equation modeling to test complex causal relationships

How can researchers design experiments to elucidate the role of BB_D15 in Borrelia burgdorferi pathogenesis?

Designing experiments to investigate BB_D15's role in pathogenesis requires a multifaceted approach:

  • Gene modification strategies:

    • Knockout/knockdown studies to assess essentiality

    • Site-directed mutagenesis to identify functional residues

    • Domain swapping to determine region-specific functions

    • Controlled expression systems to study dose-dependent effects

  • Experimental models to consider:

    • In vitro cell culture systems (mammalian cells, tick cells)

    • Ex vivo tissue models

    • Animal models of varying immunocompetence

    • Comparative studies across Borrelia species

  • Functional assays:

    • Adhesion to host cells/extracellular matrix

    • Immune evasion capabilities

    • Survival under stress conditions

    • Transmission efficiency between hosts

  • Experimental design considerations:

    • Use randomized block designs to control for host/cell variability

    • Implement blinded assessment of outcomes to reduce bias

    • Include appropriate controls (wild-type, complemented mutants)

    • Ensure adequate statistical power through proper sample sizing

  • Data integration framework:

    • Correlate molecular interactions with pathogenesis outcomes

    • Develop mathematical models of pathogen-host interactions

    • Integrate transcriptomic, proteomic, and functional data

    • Compare findings with other bacterial membrane proteins

What methodological approaches can address the challenges of studying membrane protein interactions involving BB_D15?

Studying BB_D15 interactions with other proteins and molecules presents unique challenges requiring specialized methodological approaches:

  • In vitro interaction methods:

TechniqueStrengthsLimitationsData Analysis Approach
Surface Plasmon ResonanceReal-time kinetics, label-freeRequires protein immobilizationCurve fitting to association/dissociation models
Isothermal Titration CalorimetryDirect measurement of thermodynamicsHigh protein consumptionBinding isotherm analysis
Microscale ThermophoresisLow sample consumption, solution-basedRequires fluorescent labelingConcentration-dependent mobility shifts
Cryo-EM of complexesDirect visualization of interaction interfacesChallenging for transient interactionsStructural reconstruction and difference mapping
  • In vivo/cellular approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • FRET/BRET to detect proximity in living cells

    • Co-immunoprecipitation with specialized membrane-compatible detergents

    • In vivo crosslinking followed by mass spectrometry

  • Computational methods:

    • Molecular docking simulations

    • Coevolution analysis to predict interaction interfaces

    • Network analysis of protein-protein interactions

    • Integration of structural and genomic data

  • Validation strategies:

    • Orthogonal confirmation with multiple techniques

    • Mutagenesis of predicted interaction interfaces

    • Functional assays to confirm biological relevance

    • Comparison with related proteins of known function

How can researchers develop a comprehensive analytical framework for comparing BB_D15 across different Borrelia species?

To compare BB_D15 across Borrelia species, researchers should develop a systematic analytical framework:

  • Comparative genomics approach:

    • Sequence alignment and phylogenetic analysis

    • Identification of conserved domains and variable regions

    • Promoter analysis to assess expression regulation differences

    • Assessment of selection pressure through dN/dS analysis

  • Structural comparison methodology:

    • Homology modeling of BB_D15 from different species

    • Comparison of predicted membrane topology

    • Analysis of conservation at the three-dimensional level

    • Identification of species-specific structural features

  • Functional comparison design:

    • Standardized assays across species

    • Heterologous expression systems for direct comparison

    • Chimeric proteins to identify species-specific functional domains

    • Correlation of functional differences with host tropism

  • Data integration and visualization:

    • Heat maps of sequence identity and functional parameters

    • Network visualization of interaction partners across species

    • Statistical clustering to identify functional groups

    • Machine learning to identify features associated with pathogenicity

  • Experimental design considerations:

    • Latin square designs to control for experimental batch effects

    • Factorial designs to test species and environmental factors simultaneously

    • Randomized blocking to control for host cell variability

    • Appropriate statistical analyses for multiple comparisons

What replication and validation strategies should researchers implement in BB_D15 studies?

Ensuring reproducibility in BB_D15 research requires rigorous replication and validation strategies:

  • Replication framework:

    • Technical replication: Multiple measurements from the same sample

    • Biological replication: Independent biological samples (different bacterial cultures)

    • Methodological replication: Using different techniques to measure the same parameter

    • Laboratory replication: Validation across different research groups

  • Minimum standards for replication:

    • Three independent biological replicates as a baseline

    • Power analysis to determine adequate sample size

    • Randomization in sample processing order

    • Blinding of analysis where applicable

  • Validation approaches:

    • Orthogonal techniques to confirm key findings

    • Positive and negative controls for each experimental system

    • Dose-response relationships where applicable

    • Genetic complementation to confirm specificity of mutant phenotypes

  • Documentation and reporting requirements:

    • Detailed materials and methods for full reproducibility

    • Raw data availability in public repositories

    • Reporting of unsuccessful approaches to prevent publication bias

    • Transparent reporting of statistical analyses

  • Statistical validation framework:

    • Appropriate statistical tests based on data distribution

    • Correction for multiple comparisons

    • Effect size reporting beyond p-values

    • Confidence intervals for key measurements

How should researchers approach experimental design when studying BB_D15 under varying environmental conditions?

Environmental factors can significantly impact membrane protein behavior, requiring careful experimental design:

  • Factorial design implementation:

    • 2^k factorial designs to test multiple environmental factors

    • Central composite designs for response surface modeling

    • Fractional factorial designs when resource constraints exist

    • Analysis using ANOVA with interaction terms

  • Key environmental variables to consider:

    • pH ranges relevant to tick and mammalian hosts (5.5-7.5)

    • Temperature variations (4°C, 23°C, 37°C, 41°C)

    • Oxygen tension (aerobic vs. microaerophilic conditions)

    • Nutrient availability (rich vs. minimal media)

    • Host-derived factors (serum, tissue extracts)

  • Control strategies:

    • Single-variable manipulation with other factors held constant

    • Internal controls within each environmental condition

    • Time-course studies to capture dynamic responses

    • Recovery experiments to assess reversibility of effects

  • Data analysis approach:

    • Principal component analysis to identify major sources of variation

    • Hierarchical clustering to group similar conditions

    • Heat maps to visualize responses across multiple conditions

    • Two-way ANOVA to identify interaction effects between environmental factors

  • Experimental blocking strategies:

    • Block by protein preparation batch

    • Block by time of experiment

    • Latin square designs for multifactorial studies

    • Randomize within blocks to minimize bias

What bioinformatic and computational approaches enhance BB_D15 research?

Computational methods can significantly advance BB_D15 research, particularly given the challenges of membrane protein studies:

  • Structural prediction and analysis:

    • Membrane topology prediction algorithms

    • Ab initio structure prediction using specialized membrane protein force fields

    • Molecular dynamics simulations in membrane environments

    • Ligand binding site prediction

  • Functional prediction approaches:

    • Gene ontology enrichment analysis

    • Protein-protein interaction network prediction

    • Functional domain annotation

    • Comparative analysis with characterized membrane proteins

  • Evolutionary analysis methods:

    • Phylogenetic profiling across bacterial species

    • Positive selection analysis to identify functionally important residues

    • Coevolution analysis to predict structural contacts

    • Horizontal gene transfer assessment

  • Integration with experimental data:

    • Structural modeling constrained by experimental data

    • Machine learning to identify patterns in complex datasets

    • Network analysis integrating multiple data types

    • Statistical validation of computational predictions

  • Recommended computational pipeline:

    • Initial sequence analysis and evolutionary profiling

    • Structural prediction with membrane-specific algorithms

    • Molecular dynamics to assess stability and dynamics

    • Integration with experimental data for refinement

    • Functional prediction based on structural features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.