Recombinant Borrelia burgdorferi Uncharacterized protein BB_0032 (BB_0032)

Shipped with Ice Packs
In Stock

Description

Overview of Borrelia burgdorferi

Borrelia burgdorferi is a spirochete bacterium and the causative agent of Lyme disease . Lyme disease is a prevalent vector-borne illness in the Northern Hemisphere, transmitted to humans through the bite of infected ticks . Following a tick bite, the bacteria can alter the host's immune system, potentially leading to attacks on healthy tissues . The standard treatment includes broad-spectrum antibiotics .

Genetic Heterogeneity and Virulence

Borrelia burgdorferi exhibits genetic diversity, influencing its potential for bloodstream dissemination and the severity of Lyme disease . Molecular analysis has classified B. burgdorferi into different species, with Borrelia burgdorferi sensu stricto being the primary cause of Lyme disease in North America . Variations in the genetic makeup of B. burgdorferi strains can lead to differing potentials for bloodstream dissemination, which may result from differences in genetic content and/or alterations in gene expression between isolates .

Comparative Transcriptional Profiling

Comparative transcriptional profiling is valuable for identifying differences in the transcriptomes of B. burgdorferi clinical isolates that may provide clues to pathogenesis . This approach involves assessing gene expression differences between isolates with distinct genotypes . Identifying isolate-specific patterns of gene expression can help pinpoint genes and proteins responsible for differences in pathogenicity among isolates .

Functional Analysis of Differentially Expressed Genes

Researchers employed genome arrays to assess differences in gene expression between two B. burgdorferi clinical isolates, BL206 and B356, which have differing pathogenic potentials . They found 78 open reading frames (ORFs) with significantly different expression levels between the two isolates . A notable finding was that several genes potentially involved in nutrient uptake (BB0603, BBA74, BB0329, BB0330, and BBB29) showed significantly higher expression levels in isolate B356 .

BB_0032 and Differential Gene Expression

One study utilized Borrelia burgdorferi genome arrays to determine the gene expression profiles of a virulent isolate (BL206) and an attenuated strain (B356) . This study identified open reading frames (ORFs) with significant differences in expression ratios between the isolates . These ORFs are listed in Table 2 of the cited article, which serves as a starting point for investigating factors involved in the hematogenous dissemination of B. burgdorferi .

BBA74: A Differentially Expressed Gene

The transcript level of BBA74, which encodes a protein with porin activity, was found to be more than 20-fold higher in B356 than in BL206 . Consistent with this, strain B356 contained three- to fivefold more BBA74 protein . Disruption of BBA74 in mutant strains resulted in prolonged lag phases before the induction of log-phase growth, suggesting that BBA74 may play a role in nutrient uptake required for entry into log-phase growth .

BB0238: A Key Protein for Infectivity

BB0238 is a conserved hypothetical protein of unknown function that is essential for Borrelia burgdorferi during mammalian infection . It contains a tetratricopeptide repeat (TPR) domain, which mediates protein-protein interactions . A bb0238-deficient mutant was attenuated in mice, and complementation restored infectivity to wild-type levels . BB0238 is associated with the inner membrane of the spirochete and appears to be constitutively expressed under in vitro conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize fulfilling your request.
Synonyms
BB_0032; Uncharacterized protein BB_0032
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-490
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
BB_0032
Target Protein Sequence
MKEVDENSNVELFEVKLKPILGIEPKVYVFLTTIILLLSLISTLIIIPKFKNPGAYLKIN SNIENTYIYLNEKYIGRTPLNKYINATEGVLRAKRMGFKTYEQRIKIHNKFFGNYSLQIN LELVDPEKIIKQRQKELSIMVKIKNINENTKLIPVFSLISSELKEHPKYIKKFLKDSIPY LNSTEMFKDFLNSYKAIYSIDQDNSNQEEIWNSLKTNFDLENRAIFWFLENLDKDLKILT KNAPWVKTLAKTLDNENIQLISKNEKINIKLPGFKKINSNKIEKIQNYELNSLDSKNISL KSTYNVKEFLIQEQNVTKYEYQDFLKENPKWALNNKENLIKEQLVDENYLKNFNQIGLNE AITGISYFSAIEYANWYSKKLPTGFKARLPISQEWELYQKEPNKNPLNINEISKKVGFWN LMQNSSFNEIAIFKNEKNFYSENSNFYSLITEIRTYSQQNNNLLNASTKASFLKNWSSPN IGFRLIVSKE
Uniprot No.

Target Background

Database Links

KEGG: bbu:BB_0032

STRING: 224326.BB_0032

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What approaches are recommended for initial characterization of the uncharacterized protein BB_0032?

For initial characterization of BB_0032, researchers should employ a systematic approach combining bioinformatic analysis with experimental validation. Begin with sequence homology searches against known protein databases to identify potential functional domains. Use protein structure prediction tools to generate hypothetical models of BB_0032's tertiary structure. Follow this with expression and purification of recombinant BB_0032 using methods similar to those employed for other B. burgdorferi proteins. Similar to BadP (BB0086) characterization, researchers should consider comparative transcriptomic analysis under different growth conditions to understand expression patterns . Initial functional assays should be guided by bioinformatic predictions, focusing on determining basic biochemical properties including molecular weight, isoelectric point, and potential post-translational modifications.

What expression systems are most effective for producing recombinant BB_0032?

Based on established protocols for other B. burgdorferi proteins, E. coli-based expression systems typically offer good yields for recombinant borrelial proteins. The BL21(DE3) strain is commonly used with pET vector systems, providing controlled expression through IPTG induction. When expressing BB_0032, researchers should consider optimizing for solubility by testing multiple expression conditions (temperature, induction time, and IPTG concentration). For proteins proving difficult to express in soluble form, specialized approaches may be required such as fusion tags (MBP, SUMO, or GST) to enhance solubility, or specialized E. coli strains designed for expressing challenging proteins. For studying the native conformation and potential post-translational modifications, baculovirus-insect cell expression systems may be preferable, though they typically provide lower yields than bacterial systems. Successful expression should be verified using SDS-PAGE and Western blot analysis with antibodies against the recombinant protein or fusion tag .

What experimental approaches should be used to determine if BB_0032 plays a role in host adaptation similar to BadP (BB0086)?

To investigate whether BB_0032 functions in host adaptation similar to BadP (BB0086), researchers should implement a multi-faceted experimental approach. First, conduct comparative expression analysis of BB_0032 under conditions mimicking tick midgut after blood meal versus mammalian host conditions (temperature shift from 25°C to 34°C, pH change, and serum exposure). Similar to BadP studies, both transcriptional (qRT-PCR) and translational (Western blot) analyses should be performed to detect potential post-transcriptional regulation .

Generate BB_0032 deletion mutants using allelic exchange, replacing the gene with an antibiotic resistance marker under control of a constitutive promoter such as flgB, as performed with badP . Verify deletion through PCR and complement the mutant to confirm phenotype specificity. Test the mutant strains' ability to survive in both tick and mammalian environments using in vitro models and in vivo infection studies.

For in vivo assessment, employ both mouse infection models (C3H/HeN mice) to evaluate colonization capabilities and dialysis membrane chambers (DMCs) implanted in rat peritoneal cavities to examine adaptation to the mammalian environment . Monitor the expression of known host-adaptation markers (OspA, OspC, DbpA, BBK32) in wild-type versus mutant strains to determine if BB_0032 influences their regulation. Additionally, assess the effect of BB_0032 deletion on key regulators such as RpoS and BosR to determine if it participates in the regulatory network controlling B. burgdorferi adaptation .

How can researchers determine potential protein-protein interactions involving BB_0032?

To elucidate protein-protein interactions involving BB_0032, researchers should employ multiple complementary approaches. Begin with co-immunoprecipitation (Co-IP) experiments using antibodies against BB_0032 to pull down potential interacting partners from B. burgdorferi lysates. This approach can identify stable interactions but may miss transient or weak interactions. For validation and to identify direct interactions, implement yeast two-hybrid (Y2H) screening using BB_0032 as bait against a B. burgdorferi genomic library.

More advanced techniques include proximity-dependent biotin identification (BioID) or APEX-based proximity labeling, where BB_0032 is fused to a biotin ligase to biotinylate proximal proteins in vivo. For high-throughput identification of the interactome, employ affinity purification coupled with mass spectrometry (AP-MS). Express BB_0032 with an affinity tag (such as FLAG or His), purify the protein complex, and identify components by mass spectrometry.

Validate identified interactions through reciprocal Co-IP experiments and functional assays. For suspected regulatory interactions, similar to the BadR-BadP relationship, perform electrophoretic mobility shift assays (EMSA) to detect potential DNA-binding capabilities . Additionally, implement surface plasmon resonance (SPR) or microscale thermophoresis (MST) to quantitatively assess binding affinities between BB_0032 and its putative partners. These approaches collectively provide a comprehensive view of the BB_0032 interaction network within B. burgdorferi.

What experimental design would best elucidate the potential role of BB_0032 in B. burgdorferi virulence?

A comprehensive experimental design to investigate BB_0032's role in virulence should include both in vitro and in vivo components. First, generate BB_0032 deletion mutants and complemented strains using methodologies similar to those employed for BadP studies . Compare growth characteristics of wild-type, mutant, and complemented strains in BSK medium at both tick (25°C) and mammalian (34°C) temperatures to identify potential growth defects .

Assess the effect of BB_0032 deletion on the expression of known virulence factors (OspC, DbpA, BBK32) through qRT-PCR and Western blot analysis. Examine if BB_0032 influences key regulators like RpoS and BosR, which control virulence gene expression . Conduct in vitro invasion assays using relevant cell types (endothelial cells, neuronal cells) to determine if BB_0032 affects cellular invasion capabilities.

For in vivo virulence assessment, implement mouse infection models using both needle inoculation and tick transmission. For needle inoculation, infect C3H/HeN mice with wild-type, mutant, and complemented strains (10^3-10^5 spirochetes), then monitor infection through serology, culture of tissues (skin, heart, joints), and quantitative PCR at different time points (4 days, 2 weeks, 4 weeks) post-infection . This timeline allows assessment of both early colonization and dissemination phases. For tick transmission, feed BB_0032 mutant-infected ticks on naive mice and evaluate transmission efficiency.

Additionally, utilize dialysis membrane chambers (DMCs) implanted in rat peritoneal cavities to assess the adaptation of BB_0032 mutants to the mammalian environment . Analyze protein expression profiles of recovered spirochetes to determine if BB_0032 affects the OspA-to-OspC switch and other adaptive changes necessary for mammalian infection.

What methodologies are most appropriate for investigating the structural characteristics of BB_0032?

To thoroughly investigate BB_0032's structural characteristics, researchers should implement a multi-technique approach combining computational prediction with experimental validation. Initially, employ bioinformatic tools for secondary structure prediction, domain identification, and homology modeling based on proteins with similar sequences. For experimental structure determination, purify recombinant BB_0032 to high homogeneity using affinity chromatography followed by size exclusion chromatography to ensure monodispersity.

Circular dichroism (CD) spectroscopy should be used to experimentally validate secondary structure predictions and assess thermal stability through melting curves. For tertiary structure determination, X-ray crystallography remains the gold standard if crystals can be obtained. Alternatively, cryo-electron microscopy (cryo-EM) is increasingly valuable for proteins resistant to crystallization, particularly those in complexes with interaction partners.

For proteins challenging to crystallize, nuclear magnetic resonance (NMR) spectroscopy provides valuable structural information and can additionally reveal dynamic properties. Small-angle X-ray scattering (SAXS) offers lower-resolution structural information but can be performed in solution under near-physiological conditions. If BB_0032 is membrane-associated, specialized techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) can elucidate membrane interaction regions.

For complete structural characterization, combine these techniques with functional assays guided by the structural data, such as site-directed mutagenesis of predicted functional residues. This integrated approach provides comprehensive insights into structure-function relationships of BB_0032.

How should researchers address challenges in expressing soluble recombinant BB_0032?

When encountering solubility issues with recombinant BB_0032, researchers should systematically optimize expression conditions and employ solubility-enhancing strategies. Begin by varying induction parameters—lower temperatures (16-25°C), reduced IPTG concentrations (0.1-0.5 mM), and shorter induction times often improve solubility by slowing protein expression and allowing proper folding. If these adjustments prove insufficient, implement fusion tag strategies using solubility-enhancing tags such as MBP, GST, SUMO, or Thioredoxin. These tags can be removed post-purification using specific proteases.

Consider specialized E. coli strains designed for challenging proteins, such as those co-expressing chaperones or containing mutations that enhance disulfide bond formation. For proteins with potential membrane associations, detergent screening becomes critical—test a panel of detergents including mild non-ionic (DDM, LDAO) and zwitterionic (CHAPS) varieties at concentrations above their critical micelle concentration.

If refolding is necessary, optimize buffer conditions through systematic screening of pH, ionic strength, additives (arginine, glycerol, sucrose), and redox conditions to prevent aggregation during refolding. Cell-free expression systems represent an alternative approach, allowing direct synthesis into detergent micelles or lipid nanodiscs for membrane-associated proteins.

For exceptionally challenging proteins, consider segmental labeling approaches where domains are expressed separately and reconstituted. Throughout optimization, employ multiple analytical techniques (dynamic light scattering, size exclusion chromatography, thermal shift assays) to assess protein quality and homogeneity, prioritizing function over yield.

What strategies are recommended for resolving contradictory data when analyzing BB_0032 expression across different experimental conditions?

When confronted with contradictory BB_0032 expression data across experimental conditions, researchers should implement a systematic troubleshooting approach. First, validate all methodologies—for transcriptional analysis, verify primer specificity through melt curve analysis, sequencing of amplicons, and standard curve generation to ensure reliable qRT-PCR results. For protein detection, validate antibody specificity using recombinant protein and knockout strain controls .

Analyze potential experimental variables that might explain discrepancies, including subtle differences in growth conditions, media composition, bacterial density, and passage number. As observed in B. burgdorferi research, expression patterns can vary significantly between low and high-passage cultures . Implement strict standardization of experimental protocols, documenting all potential variables and conducting parallel processing of samples to minimize batch effects.

Consider temporal dynamics—BB_0032 expression might follow complex patterns over time, requiring time-course experiments rather than single time-point measurements. Additionally, examine post-transcriptional regulation by comparing RNA and protein levels simultaneously, as observed with other B. burgdorferi proteins where transcriptional and translational levels don't always correlate .

For particularly challenging contradictions, implement orthogonal techniques—if qRT-PCR and microarray data conflict, perform RNA-seq analysis or northern blotting. Similarly, if Western blot and mass spectrometry protein quantification differ, consider alternative protein detection methods such as ELISA or proximity ligation assays.

Statistical robustness is crucial—conduct appropriate statistical tests, implement multiple biological and technical replicates (minimum n=3), and consider Bayesian statistical approaches for integrating conflicting datasets. When publishing, transparently report all contradictory findings with possible explanations rather than selectively reporting data that fits a particular hypothesis.

What analytical approaches should be used to interpret RNA-seq data for BB_0032 expression across different strains and conditions?

When analyzing RNA-seq data for BB_0032 expression across different strains and conditions, researchers should implement a comprehensive analytical pipeline that accounts for the unique aspects of B. burgdorferi transcriptomics. Begin with rigorous quality control of raw sequences using FastQC, followed by adapter trimming and removal of low-quality reads. Align processed reads to the appropriate B. burgdorferi reference genome, noting that strain differences may necessitate using strain-specific references or de novo transcript assembly approaches.

Implement appropriate statistical models that account for both biological and technical variability. For multi-factorial experiments (strain × temperature × time), use models that can detect interaction effects. Apply multiple testing correction (Benjamini-Hochberg procedure) to control false discovery rates when identifying differentially expressed genes.

Beyond differential expression analysis, employ clustering approaches (hierarchical clustering, k-means) to identify co-expressed genes that might share regulatory mechanisms with BB_0032. Conduct pathway enrichment analysis to place BB_0032 in a functional context, recognizing that many B. burgdorferi genes remain uncharacterized. Where possible, integrate transcriptomic data with other omics data types (proteomics, metabolomics) to identify post-transcriptional regulation effects.

For visualization, generate heat maps of expression across conditions, volcano plots for differential expression analysis, and network diagrams showing potential regulatory relationships. These approaches collectively provide comprehensive insights into BB_0032 expression patterns and regulatory contexts.

How can researchers determine whether BB_0032 plays a role in the regulatory network controlling B. burgdorferi adaptation?

To determine if BB_0032 participates in B. burgdorferi's regulatory network for host adaptation, researchers should implement a multi-level experimental strategy. Begin by analyzing the effects of BB_0032 deletion on global gene expression using RNA-seq or microarray analysis. Compare transcriptomes of wild-type and BB_0032 mutant strains under conditions mimicking both tick and mammalian environments, focusing particularly on known adaptation-related genes and regulatory factors like RpoS and BosR .

Generate double mutants lacking both BB_0032 and known regulators (RpoS, BosR, RelBbu, BadR) to assess potential epistatic relationships. If BB_0032 functions in the same pathway as these regulators, specific patterns of epistasis would be expected. Implement chromatin immunoprecipitation sequencing (ChIP-seq) to identify potential DNA-binding sites if bioinformatic analysis suggests DNA-binding capability for BB_0032.

For protein-level regulation assessment, examine the impact of BB_0032 deletion on the proteome using mass spectrometry-based approaches. Quantitative proteomics can reveal post-transcriptional effects that might not be apparent in transcriptomic data. Additionally, perform phosphoproteomics analysis to identify potential regulatory phosphorylation events affected by BB_0032.

Complementary approaches include bacterial two-hybrid assays to test direct interactions between BB_0032 and known regulatory proteins, and electrophoretic mobility shift assays (EMSA) if BB_0032 is predicted to bind DNA. If BB_0032 exhibits enzymatic activity, biochemical assays should be developed to characterize its activity and identify potential substrates within the regulatory network.

For comprehensive pathway mapping, implement network analysis of all generated data, constructing predictive models of how BB_0032 integrates into known regulatory circuits controlling adaptation, similar to analyses performed for BadP and BadR . Validate key predictions from these models through targeted experimentation to confirm the regulatory role of BB_0032.

How might CRISPR-Cas9 genome editing techniques be applied to study BB_0032 function in B. burgdorferi?

CRISPR-Cas9 genome editing offers transformative potential for studying BB_0032 function in B. burgdorferi, though with specific considerations for this challenging organism. Researchers should develop a B. burgdorferi-optimized CRISPR-Cas9 system using codon-optimized Cas9 under control of a constitutive borrelial promoter (such as flgB) and sgRNAs designed with B. burgdorferi-specific parameters. For delivery, electroporation protocols similar to those used for traditional genetic manipulation can be employed, though with optimization for larger CRISPR components .

Beyond simple gene knockout as achieved with traditional methods, CRISPR enables more sophisticated genetic manipulations. Implement precise point mutations in BB_0032 to assess the importance of specific amino acids without disrupting the entire protein. Generate conditional knockdowns using CRISPR interference (CRISPRi) by expressing catalytically inactive dCas9 fused to a repressor domain, allowing temporal control of BB_0032 expression to distinguish between developmental and physiological functions.

For functional domain analysis, perform scarless multiple edits to selectively remove predicted domains while maintaining reading frame. Create reporter fusions by inserting fluorescent protein genes at the BB_0032 locus to monitor expression patterns in real-time during infection, particularly during host adaptation processes. Additionally, implement CRISPR activation (CRISPRa) approaches to upregulate BB_0032 expression, potentially revealing phenotypes masked by compensatory mechanisms.

To address off-target concerns, perform whole-genome sequencing of edited strains and implement high-fidelity Cas9 variants. For multiplexed editing, design sgRNA arrays targeting BB_0032 alongside genes suspected of functional relationships to reveal genetic interactions and redundancies. These advanced CRISPR applications would significantly accelerate understanding of BB_0032 function beyond what traditional genetic approaches have achieved with other B. burgdorferi proteins like BadP .

What emerging technologies might enhance our understanding of BB_0032's role in B. burgdorferi pathogenesis?

Several cutting-edge technologies show promise for elucidating BB_0032's role in B. burgdorferi pathogenesis. Single-cell RNA-seq (scRNA-seq) applied to infected host tissues can reveal heterogeneity in bacterial gene expression during infection, potentially identifying distinct subpopulations where BB_0032 plays critical roles. While technically challenging with bacterial cells, advances in bacterial scRNA-seq protocols make this increasingly feasible.

Spatial transcriptomics technologies can map BB_0032 expression within infected tissues, correlating expression with specific microenvironments and providing insights into tissue-specific functions. Similarly, advanced imaging approaches including super-resolution microscopy and expansion microscopy can determine BB_0032's subcellular localization with unprecedented precision, potentially revealing associations with specific cellular structures.

For functional analysis, CRISPR interference (CRISPRi) enables conditional, titratable knockdown of BB_0032 at specific infection stages, overcoming limitations of traditional knockouts that may have developmental consequences masking later functional roles. Complementarily, optogenetic or chemogenetic tools adapted for B. burgdorferi would allow temporal control of BB_0032 activity in vivo.

Metaproteomics and metabolomics approaches applied to infected tissues can reveal how BB_0032 influences the host-pathogen interface, potentially identifying altered metabolic pathways or host response patterns. For structural insights, AlphaFold2 and other AI-driven protein structure prediction tools can generate increasingly accurate models of BB_0032's structure, even without experimental structural data.

Long-read sequencing technologies applied to BB_0032 transcripts may identify alternative splicing or RNA processing events not detectable with short-read approaches. Additionally, synthetic biology approaches including minimal genome construction could determine if BB_0032 belongs to the essential gene set of B. burgdorferi. These emerging technologies collectively promise to provide multi-dimensional insights into BB_0032's pathogenic functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.