Recombinant Borrelia burgdorferi Uncharacterized protein BB_0044 (BB_0044)

Shipped with Ice Packs
In Stock

Description

Significance of BB_0044 in Lyme Disease Research

The significance of BB_0044 lies in its potential roles in the pathogenesis of Lyme disease. As an uncharacterized protein, it may be involved in various biological processes such as:

  • Immune Evasion: Many proteins in B. burgdorferi are known to play roles in evading the host immune response.

  • Adhesion and Colonization: Proteins that facilitate attachment to host tissues are critical for establishing infection.

  • Nutrient Acquisition: Understanding how B. burgdorferi acquires essential nutrients can reveal vulnerabilities that could be targeted therapeutically.

Research Findings on BB_0044

Recent studies have aimed to characterize recombinant proteins from B. burgdorferi, including BB_0044. These studies typically involve expressing the protein in a suitable host (often Escherichia coli) and assessing its properties through various biochemical techniques.

Expression and Purification

The expression of recombinant BB_0044 involves cloning the corresponding gene into an expression vector, followed by transformation into a bacterial host for protein production. The purification process often includes:

  • Affinity Chromatography: Utilizing tags (such as His-tags) for isolating the protein from bacterial lysates.

  • Size Exclusion Chromatography: To further purify the protein based on size.

Functional Assays

Functional assays are critical for determining the role of BB_0044. These may include:

  • Binding Studies: Assessing how well BB_0044 interacts with host proteins or other molecules.

  • Immunogenicity Tests: Evaluating whether BB_0044 elicits an immune response in infected individuals, which could indicate its role in pathogenesis.

Data Table on Recombinant Protein Characteristics

The following table summarizes key characteristics of recombinant BB_0044 based on available research data:

CharacteristicDescription
Molecular WeightApproximately XX kDa (to be determined)
Expression SystemE. coli BL21(DE3)
Purification MethodAffinity chromatography
Functionality AssaysBinding assays, immunogenicity tests
Potential ApplicationsVaccine development, serodiagnosis

Future Directions

Future research should focus on:

  • Detailed Characterization: Employing advanced techniques such as mass spectrometry to elucidate the structure and function of BB_0044.

  • In Vivo Studies: Investigating the role of BB_0044 in animal models to understand its contribution to infection dynamics.

  • Vaccine Development: Exploring whether BB_0044 can be utilized as a candidate antigen for vaccine formulation against Lyme disease.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BB_0044; Uncharacterized protein BB_0044
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
BB_0044
Target Protein Sequence
MQDRKFSFRKYFLISVFLIFIVSGITYFYSTQMLEKSQKCVEDNLDAKVKLVDMEDFYFD LNECLNMDDFFIPRPDFLNENLNKNLVVDGLIKNKFLDENFFKDLWIKKENLFNVDIEKE NEKLIDKILEISK
Uniprot No.

Target Background

Database Links

KEGG: bbu:BB_0044

STRING: 224326.BB_0044

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the optimal expression systems for recombinant production of BB_0044?

For recombinant BB_0044 expression, E. coli-based systems using pET vectors remain the most efficient approach. Based on experiences with similar Borrelia proteins, BL21(DE3) strains typically yield optimal expression when the BB_0044 gene is codon-optimized for E. coli. For improved solubility, consider fusion tags such as MBP or SUMO, as Borrelia membrane-associated proteins often present solubility challenges.

The methodology typically involves:

  • Cloning the BB_0044 gene into a pET vector with an appropriate fusion tag

  • Transformation into BL21(DE3) or Rosetta(DE3) E. coli cells

  • Induction with 0.5-1.0 mM IPTG at lower temperatures (16-25°C) to enhance solubility

  • Purification using affinity chromatography followed by size exclusion chromatography

This approach has been successfully employed for other Borrelia proteins as demonstrated in research examining recombinant antigens from multiple Borrelia species .

How can researchers confirm the identity and purity of recombinant BB_0044?

Confirmation of recombinant BB_0044 identity and purity requires a multi-analytical approach. SDS-PAGE analysis remains the primary screening method, where BB_0044 should appear at its predicted molecular weight. For definitive identification, mass spectrometry analysis using LC-MS/MS is recommended to confirm the protein sequence.

Methodological steps include:

  • SDS-PAGE analysis with Coomassie staining to assess purity (>90% purity is typically suitable for most applications)

  • Western blot using anti-His or anti-tag antibodies if a tag was incorporated

  • LC-MS/MS analysis of tryptic digests to confirm protein identity

  • Circular dichroism spectroscopy to verify proper protein folding

For highest purity applications such as crystallography, additional chromatographic steps including ion exchange chromatography may be necessary to achieve >95% purity. Similar quality control methods have been applied to recombinant proteins used in Lyme immunoblot testing .

What bioinformatic tools are most useful for predicting BB_0044 structure and function?

For an uncharacterized protein like BB_0044, bioinformatic analysis provides crucial preliminary insights. Start with sequence alignment tools like BLAST to identify homologous proteins across Borrelia species and potentially other bacterial genera. For structural predictions, AlphaFold2 and RoseTTAFold have revolutionized protein structure prediction and should be your primary tools.

Recommended analytical pipeline:

  • Primary structure analysis using ExPASy ProtParam for basic physicochemical properties

  • Secondary structure prediction using PSIPRED or JPred

  • Tertiary structure prediction using AlphaFold2 or RoseTTAFold

  • Domain identification using PFAM, SMART, or InterProScan

  • Cellular localization prediction using PSORT, SignalP, and TMHMM

  • Functional annotation using GO terms and STRING for potential protein-protein interactions

This multi-tool approach has proven effective for initial characterization of uncharacterized proteins in various bacterial systems, providing direction for subsequent experimental validation.

How does BB_0044 expression vary throughout the Borrelia burgdorferi infection cycle in ticks and mammals?

Understanding BB_0044 expression patterns requires temporal analysis across the complex life cycle of B. burgdorferi. Based on studies of other Borrelia proteins, RNA sequencing and quantitative PCR remain the gold standards for expression analysis.

Methodological approach:

  • Design BB_0044-specific qPCR primers and validate efficiency

  • Extract RNA from B. burgdorferi cultured under different conditions mimicking tick (23°C, pH 7.6) and mammalian (37°C, pH 6.8) environments

  • For in vivo analysis, collect samples from infected ticks at various feeding stages and from mouse tissues at different infection timepoints

  • Normalize expression against constitutive genes like flaB or recA

  • Complement RNA data with protein-level analysis using specific antibodies if available

For comprehensive analysis, consider the experimental design used for BB0405 analysis, which revealed differential expression patterns throughout the infection cycle . Similar to BB0405, BB_0044 might show stage-specific expression that correlates with particular phases of infection.

What experimental approaches can determine whether BB_0044 is surface-exposed and immunogenic during infection?

Determining surface exposure and immunogenicity of BB_0044 requires multiple complementary approaches. Surface localization can be assessed through protease accessibility assays, immunofluorescence microscopy, and surface biotinylation.

Experimental workflow:

  • Surface localization studies:

    • Protease accessibility: Treat intact B. burgdorferi with proteases like proteinase K or trypsin, then analyze BB_0044 degradation by Western blot

    • Immunofluorescence microscopy: Use anti-BB_0044 antibodies without permeabilization to detect surface-exposed epitopes

    • Surface biotinylation: Label surface proteins with biotin, then capture and analyze by Western blot

  • Immunogenicity assessment:

    • Collect sera from mice infected with B. burgdorferi at various timepoints

    • Perform ELISA using recombinant BB_0044 to detect specific antibodies

    • Conduct immunoblot analysis to confirm specificity

    • Compare results with known immunogenic proteins like OspC as positive controls

These approaches mirror those used for BB0405, which interestingly was found to be surface-exposed yet failed to elicit detectable antibody responses during natural infection despite being highly immunogenic when used as a recombinant protein .

What knockout and complementation strategies are most effective for functional characterization of BB_0044?

Genetic manipulation of B. burgdorferi to create BB_0044 knockout strains presents significant challenges due to the organism's complex genome and fastidious growth requirements. Nevertheless, targeted gene deletion remains essential for functional characterization.

Recommended methodology:

  • Generate a knockout construct containing:

    • ~1-2 kb homologous sequences flanking the BB_0044 gene

    • An antibiotic resistance cassette (typically kanamycin or streptomycin resistance)

    • Confirm proper construction by sequencing

  • Transform B. burgdorferi using electroporation:

    • Culture B. burgdorferi to mid-log phase

    • Prepare electrocompetent cells with careful washing steps

    • Electroporate with 10-20 μg of the knockout construct

    • Select transformants on BSK-II medium with appropriate antibiotics

  • Confirm knockout by:

    • PCR verification of correct insertion

    • RT-PCR or Western blot to confirm absence of BB_0044 expression

    • Whole genome sequencing to ensure no off-target effects

  • Generate complementation strains:

    • Clone BB_0044 with its native promoter into a shuttle vector

    • Transform the knockout strain and select with a second antibiotic

    • Verify expression of the complemented gene

This genetic approach has been successfully applied to BB0405, revealing its essential role in tick-to-host transmission .

How do antibody responses against BB_0044 compare to those against established Borrelia antigens used in diagnostic assays?

Comparing BB_0044 antibody responses to established diagnostic antigens requires systematic serological analysis using well-characterized serum panels.

Methodological approach:

  • Develop standardized ELISAs for BB_0044 and control antigens:

    • Use equivalently purified recombinant proteins

    • Optimize coating concentrations and blocking conditions

    • Establish standard curves using reference antibodies

  • Create a comprehensive testing panel:

    • Early Lyme disease sera (EM rash, <30 days)

    • Late Lyme disease sera (arthritis, neuroborreliosis)

    • Post-treatment Lyme disease sera

    • Tick-borne relapsing fever sera for cross-reactivity

    • Healthy controls from endemic and non-endemic regions

  • Comparative analysis:

    • Measure IgM and IgG responses separately

    • Calculate sensitivity and specificity metrics

    • Perform time-course studies to determine seroconversion patterns

Based on findings with BB0405, which remained "invisible" to the immune system during natural infection despite being surface-exposed , BB_0044 should be evaluated for similar properties, as immune evasion characteristics significantly impact diagnostic utility.

What epitope mapping techniques are most effective for identifying immunodominant regions of BB_0044?

Identifying immunodominant epitopes within BB_0044 requires systematic epitope mapping using complementary methods.

Recommended techniques:

  • Peptide array mapping:

    • Synthesize overlapping peptides (15-mers, 5 aa overlap) spanning the entire BB_0044 sequence

    • Probe with sera from infected individuals or immunized animals

    • Identify reactive peptides by fluorescence or colorimetric detection

  • Phage display library:

    • Create BB_0044 fragment library in phage display vectors

    • Select immunoreactive phages using purified antibodies

    • Sequence inserts to identify binding regions

  • Hydrogen-deuterium exchange mass spectrometry:

    • Compare deuterium uptake of BB_0044 alone versus antibody-bound

    • Regions with reduced exchange when antibody-bound indicate epitopes

  • X-ray crystallography or cryo-EM:

    • For definitive epitope mapping, solve structure of BB_0044-antibody complex

    • Provides atomic-level details of antibody-antigen interface

The resulting epitope data can guide the design of diagnostic assays using synthetic peptides or recombinant fragments containing immunodominant regions, potentially improving sensitivity and specificity compared to whole-protein assays.

What are the optimal conditions for detecting BB_0044 in immunoblot assays for Lyme disease diagnosis?

Developing optimal immunoblot conditions for BB_0044 detection requires systematic optimization of multiple parameters.

Optimization protocol:

  • Recombinant protein preparation:

    • Express BB_0044 with minimal tags to reduce interference

    • Verify proper folding via circular dichroism if conformational epitopes are important

    • Determine optimal protein concentration (typically 0.1-0.5 μg per lane)

  • Immunoblot parameters:

    • Compare PVDF and nitrocellulose membranes for optimal signal-to-noise ratio

    • Evaluate different blocking agents (BSA, milk, commercial blockers)

    • Optimize primary antibody dilutions and incubation conditions

    • Test various detection systems (HRP, AP, fluorescence)

  • Validation process:

    • Establish positive and negative controls

    • Determine band intensity scoring criteria

    • Calculate intra- and inter-assay variability

    • Compare sensitivity and specificity with established Lyme immunoblot markers

The Lyme immunoblot format described in the research, which uses recombinant proteins rather than whole-cell lysates, provides an excellent framework for incorporating BB_0044 into diagnostic platforms .

How can researchers address the challenges of BB_0044 solubility and stability during recombinant expression?

Borrelia membrane proteins often present solubility challenges during recombinant expression. A systematic approach to solubility enhancement is essential.

Problem-solving methodology:

  • Expression system modifications:

    • Test multiple E. coli strains (BL21, Rosetta, Origami, Arctic Express)

    • Evaluate induction at low temperatures (16-20°C) and reduced IPTG concentrations

    • Consider auto-induction media for gradual protein expression

  • Construct optimization:

    • Express truncated versions lacking predicted membrane domains

    • Try multiple fusion partners (MBP, SUMO, TrxA, GST)

    • Optimize codon usage for E. coli

  • Solubilization strategies:

    • Screen detergents for membrane protein extraction:

    DetergentConcentration RangeAdvantagesLimitations
    Triton X-1000.1-1%Mild, preserves activityNot MS-compatible
    DDM0.05-0.5%Good for membrane proteinsExpensive
    CHAPS0.5-2%Zwitterionic, less denaturingLimited solubilization
    Sarkosyl0.5-2%Effective solubilizationMore denaturing
  • Refolding approaches:

    • Express as inclusion bodies and refold via dialysis

    • Use on-column refolding during purification

    • Employ additives like arginine or low concentrations of urea

This comprehensive approach has been successful for other challenging Borrelia membrane proteins and should be adaptable for BB_0044.

What is the suspected role of BB_0044 in Borrelia pathogenesis based on homology and expression patterns?

Determining BB_0044's role requires integrating multiple lines of evidence from bioinformatics, expression analysis, and comparative studies with characterized proteins.

Investigative approach:

  • Homology-based function prediction:

    • Perform sensitive sequence searches using PSI-BLAST and HHpred

    • Analyze predicted structural features using AlphaFold models

    • Examine genomic context for operonic relationships

  • Expression pattern analysis:

    • Compare BB_0044 expression across infection stages by RNA-seq

    • Correlate expression with key infection events (transmission, dissemination)

    • Examine regulation by environmental factors (temperature, pH, nutrient limitation)

  • Comparative analysis with characterized proteins:

    • Identify proteins with similar expression patterns

    • Compare with BB0405, which has essential roles in transmission

    • Analyze co-expression networks to identify functional associations

This systematic approach leverages multiple data types to generate testable hypotheses about BB_0044 function for subsequent experimental validation. Studies of BB0405 revealed it to be essential for tick-to-mammalian transmission despite being downregulated during this process , suggesting BB_0044 might have similarly complex regulatory patterns with important functional implications.

What protein-protein interaction studies can reveal BB_0044's role in Borrelia burgdorferi biology?

Understanding BB_0044's interactions with other bacterial or host proteins can provide critical insights into its biological function. Multiple complementary approaches should be employed.

Experimental approaches:

  • Pull-down assays:

    • Express recombinant BB_0044 with affinity tags

    • Incubate with B. burgdorferi lysates or host cell extracts

    • Identify binding partners by mass spectrometry

  • Bacterial two-hybrid system:

    • Screen against B. burgdorferi genomic library

    • Validate interactions with co-immunoprecipitation

  • Crosslinking studies:

    • Use in vivo crosslinking with formaldehyde or DSP

    • Purify BB_0044 complexes under denaturing conditions

    • Identify crosslinked partners by mass spectrometry

  • Co-localization studies:

    • Use fluorescently labeled antibodies against BB_0044 and potential partners

    • Analyze by confocal microscopy for spatial overlap

This multi-technique approach compensates for the limitations of individual methods and provides stronger evidence for biologically relevant interactions.

How can researchers determine if BB_0044 is potentially useful as a diagnostic marker or vaccine candidate?

Evaluating BB_0044 as a diagnostic marker or vaccine candidate requires systematic investigation of its conservation, immunogenicity, and protective potential.

Research strategy:

  • Conservation analysis:

    • Analyze BB_0044 sequence conservation across Borrelia genospecies using bioinformatics

    • Assess cross-reactivity of anti-BB_0044 antibodies against different Borrelia species

    • Evaluate specificity by testing for reactions with related spirochetes

  • Diagnostic potential assessment:

    • Develop immunoassays (ELISA, immunoblots) using recombinant BB_0044

    • Test against serum panels from:

      • Confirmed Lyme disease patients at different disease stages

      • Patients with other tick-borne diseases

      • Healthy controls from endemic and non-endemic areas

    • Calculate sensitivity, specificity, and predictive values

  • Vaccine candidate evaluation:

    • Immunize mice with recombinant BB_0044 using different adjuvants

    • Measure antibody titers and persistence over time

    • Challenge with live B. burgdorferi via tick feeding or needle inoculation

    • Assess protection by quantitative PCR and culture of tissues

These approaches align with methodologies used for immunoblot diagnostics and the evaluation of BB0405 as a transmission-blocking vaccine candidate . Notably, BB0405 demonstrated the unusual property of being essential for infectivity while remaining immunologically "invisible" during natural infection, yet capable of eliciting protective immunity when used as a vaccine .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.