Recombinant Borrelia burgdorferi Uncharacterized protein BB_0073 (BB_0073)

Shipped with Ice Packs
In Stock

Description

Introduction to BB_0073

Borrelia burgdorferi, transmitted to humans through the bite of infected Ixodes ticks, causes Lyme disease - a multisystem disorder that can lead to arthritis, carditis, and neurological complications if left untreated . The genome of B. burgdorferi consists of one linear chromosome with 843 genes and 21 plasmids containing 670 genes and 167 pseudogenes . Among these, the gene BB_0073 encodes an uncharacterized protein that has garnered research interest.

Unlike many bacterial pathogens, B. burgdorferi lacks traditionally defined virulence determinants such as lipopolysaccharides, specialized secretion systems, and toxins . Instead, it has evolved various mechanisms for host survival including tick and host protein utilization, complement evasion, specific niche localization, and dynamic genetic regulation . Uncharacterized proteins like BB_0073 may play crucial roles in these processes, making their study essential for understanding B. burgdorferi pathogenicity.

Table 1: Physical and Chemical Properties of BB_0073

PropertyDescription
Protein LengthFull Length (1-186 amino acids)
UniProt IDO51100
Gene NameBB_0073
SpeciesBorrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Amino Acid SequenceMTNNLIACLIINNLTLIHFVGFEDIKIKNNIMLIKRYAIITITSLLIYSISFYLYKLFAKNNLLFLVPIFYVILIYVLILLFKVLNDLFIVYNKKSNYSNDFMLSNSSLIAITFFALDKNNGFFEGLEILILSALGILIALMSITSIKKNFDKNPKINILENEPIYFFIIFILSLIPNIIIILIYNQ
Purity (Recombinant)Greater than 90% as determined by SDS-PAGE
Protein NamesRecommended name: Uncharacterized protein BB_0073

Analysis of the amino acid sequence reveals multiple hydrophobic regions within BB_0073, suggesting potential transmembrane domains or membrane-associating regions. This characteristic is consistent with many Borrelia membrane proteins involved in host-pathogen interactions. While the three-dimensional structure remains undetermined experimentally, computational analyses may provide insights into its potential structural features and functional domains.

The presence of hydrophobic amino acid stretches (such as LIACLIINN, ILIYVLILLFK, and ILIALMSITSIK) is particularly noteworthy, as such regions often indicate membrane association in bacterial proteins. This feature aligns with observations in other Borrelia proteins like BB0172 and BB0173, which function in the bacterial membrane system .

Recombinant Production and Characterization

Recombinant versions of BB_0073 have been produced for research purposes, primarily using E. coli expression systems. These recombinant proteins typically include tags to facilitate purification and detection. Table 2 summarizes the characteristics of commercially available recombinant BB_0073.

Table 2: Characteristics of Recombinant BB_0073

CharacteristicDescription
Expression SystemE. coli
TagHis-tag (N-terminal)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Expression RegionFull length (1-186)
Product ApplicationsResearch purposes, ELISA
Commercial AvailabilityYes, from multiple suppliers

The production of recombinant BB_0073 typically follows standard recombinant protein production protocols, including gene cloning into an expression vector, transformation into E. coli, protein expression induction, and purification using affinity chromatography based on the His-tag. This process yields highly pure protein suitable for various research applications.

Proper storage and handling of recombinant BB_0073 are crucial for maintaining its integrity and biological activity. Table 3 provides detailed recommendations for optimal storage and handling conditions.

Contextual Analysis and Potential Functions

While BB_0073 remains uncharacterized in terms of its specific function, analyzing it within the context of other Borrelia proteins provides valuable insights into its potential roles. The B. burgdorferi genome encodes over 120 lipoproteins, with approximately two-thirds localizing to the bacterial surface , forming a complex and adaptable host-pathogen interface.

Several characterized B. burgdorferi proteins demonstrate the diversity of functions within this pathogen:

  1. BB0172 functions as an outer membrane protein capable of binding integrin α3β1, likely facilitating host-pathogen interactions .

  2. BB0173, in contrast to BB0172, is an inner membrane protein containing a von Willebrand Factor A (VWFA) domain exposed to the periplasmic space and an aerotolerance regulator domain, with expression regulated by oxygen availability .

  3. BB0365 is a periplasmic lipoprotein essential for all phases of Lyme disease infection, potentially functioning as a component of the sodium pump or as a metalloenzyme coordinating Zn²⁺ through histidine residues .

  4. BBA03 provides a competitive advantage to spirochetes during tick transmission to mammalian hosts, though fully competent by itself, it enhances infection efficiency when co-expressed with wild-type B. burgdorferi .

While the specific function of BB_0073 remains unknown, its hydrophobic regions suggest potential membrane localization. It may play roles in processes similar to other Borrelia membrane proteins, potentially involving host-pathogen interactions, environmental adaptation, or bacterial survival mechanisms.

Research Applications and Future Directions

Recombinant BB_0073 offers several valuable applications in Borrelia research, as outlined in Table 4.

Table 4: Research Applications of Recombinant BB_0073

ApplicationDescription
Antibody ProductionGeneration of specific antibodies for detecting and studying native BB_0073 in B. burgdorferi
Functional StudiesInvestigation of potential interactions with host molecules or other bacterial proteins
Structural StudiesDetermination of three-dimensional structure through crystallography or other methods
Differential Expression AnalysisExamination of BB_0073 expression under various environmental conditions
Comparative ProteomicsComparison with homologous proteins in other Borrelia species or strains
Diagnostic DevelopmentExploration as a potential biomarker for Lyme disease detection

The recent development of the Borrelia PeptideAtlas, a publicly available repository containing proteomic data from multiple Borrelia isolates , offers a valuable resource for researchers studying BB_0073. This database includes information from 35 different experiment datasets with 855 mass spectrometry runs, identifying 76,936 distinct peptides mapping to 1,221 canonical proteins and covering 86% of the total B31 proteome .

Future research on BB_0073 should focus on:

  1. Determining precise cellular localization using techniques such as protease protection assays and detergent phase separation assays, similar to methods used for characterizing BB0173 .

  2. Investigating expression patterns under different environmental conditions, particularly during transitions between tick vector and mammalian host.

  3. Generating knockout or mutant strains to assess the effect on bacterial viability, infectivity, and transmission.

  4. Performing interaction studies to identify potential binding partners within the bacterium or host.

  5. Structural characterization through experimental methods such as X-ray crystallography, similar to approaches used for BB0365 .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
BB_0073; Uncharacterized protein BB_0073
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
BB_0073
Target Protein Sequence
MTNNLIACLIINNLTLIHFVGFEDIKIKNNIMLIKRYAIITITSLLIYSISFYLYKLFAK NNLLFLVPIFYVILIYVLILLFKVLNDLFIVYNKKSNYSNDFMLSNSSLIAITFFALDKN NGFFEGLEILILSALGILIALMSITSIKKNFDKNPKINILENEPIYFFIIFILSLIPNII ILIYNQ
Uniprot No.

Target Background

Database Links

KEGG: bbu:BB_0073

STRING: 224326.BB_0073

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What structural information is currently available for BB_0073?

Currently, no crystal structure has been determined for BB_0073. Unlike other characterized B. burgdorferi proteins such as BB0365 (which has been crystallized and shown to adopt a fold similar to subunits of sodium-translocating oxidoreductase complexes ) or BBA73 (which forms homodimers through N-terminal α-helices ), BB_0073 remains structurally uncharacterized.

Computational prediction methods suggest BB_0073 contains multiple hydrophobic regions typical of membrane proteins. Researchers interested in structural characterization would need to employ techniques such as X-ray crystallography or NMR spectroscopy, which have been successfully applied to other B. burgdorferi proteins like BB0323 and BB0238 .

What expression systems are recommended for producing recombinant BB_0073?

Recombinant BB_0073 has been successfully expressed in E. coli with an N-terminal His-tag . For membrane proteins like BB_0073, the following expression methodology is recommended:

Table 1: Recommended Expression Systems for BB_0073

Expression SystemAdvantagesConsiderations
E. coliCost-effective, high yieldMay require optimization for membrane proteins; inclusion bodies possible
Baculovirus/Insect cellsBetter folding for complex proteinsHigher cost, longer production time
Yeast systemsPost-translational modificationsLower yield than bacterial systems
Mammalian cellsMost native-like protein foldingHighest cost, complex setup

When working with BB_0073, researchers should consider detergent screening for solubilization if the protein associates with membranes, as suggested by its sequence characteristics . For purification, immobilized metal affinity chromatography (IMAC) with His-tagged constructs has been successfully employed .

What methodological approaches are most effective for functional characterization of uncharacterized proteins like BB_0073?

For uncharacterized proteins like BB_0073, a multi-faceted approach is recommended:

  • Comparative genomics analysis: Compare BB_0073 with other Borrelia proteins of known function. While BB_0073 remains uncharacterized, similar methodologies used for BB0365 and BB0238 could be applied.

  • Protein-protein interaction studies: Techniques such as pull-down assays, yeast two-hybrid screens, or co-immunoprecipitation can identify interaction partners. This approach revealed that BB0323 interacts with BB0238 and BB0108, providing insights into their roles in microbial immune evasion .

  • Gene knockout/knockdown studies: Creating BB_0073 deletion mutants, similar to studies conducted with plzA (BB0733) , could reveal its role in B. burgdorferi physiology or pathogenesis.

  • Metal binding assays: Given that several B. burgdorferi proteins coordinate metal ions (e.g., BB0365 coordinates Zn²⁺ ), assessing metal binding properties of BB_0073 using techniques such as inductively coupled plasma mass spectrometry (ICP-MS) or isothermal titration calorimetry (ITC) could provide functional insights.

  • Transcriptomic analysis: Examining expression patterns of BB_0073 under different conditions (tick host vs. mammalian host) could indicate its role in the infection cycle.

How might BB_0073 contribute to Borrelia burgdorferi pathogenesis or survival?

While the specific function of BB_0073 remains unknown, several hypotheses can be proposed based on studies of other B. burgdorferi proteins:

  • Potential role in host adaptation: Like BBA73, which undergoes dramatic upregulation during transmission from ticks to mammals , BB_0073 might play a role in adaptation to different host environments.

  • Possible involvement in immune evasion: Similar to BB0238 and BB0323, which facilitate microbial immune evasion through protein-protein interactions , BB_0073 may contribute to immune evasion mechanisms.

  • Potential function in nutrient acquisition: Given that B. burgdorferi is deficient in pathways for amino acid synthesis , BB_0073 might, like the aminopeptidase encoded by BB0069, play a role in supplying required amino acids.

  • Possible membrane transport function: The hydrophobic nature of BB_0073 suggests it may function as a membrane transporter, potentially similar to BB0164, which is involved in manganese homeostasis and resistance to reactive oxygen species .

What is known about the expression pattern of BB_0073 during different stages of the Borrelia life cycle?

  • Employ quantitative PCR to measure BB_0073 transcript levels in B. burgdorferi cultured under conditions mimicking tick vector (23°C, pH 7.6) versus mammalian host (37°C, pH 6.8).

  • Use Western blotting with anti-BB_0073 antibodies to detect protein expression levels across different growth conditions and infection stages.

  • Apply RNA-seq analysis to comprehensively examine transcriptional changes, including BB_0073, during host adaptation.

For context, proteins like BBA73 show dramatic upregulation during transmission from ticks to mammals , while others like PlzA (BB0733) are expressed throughout the infection cycle and are essential for its completion .

How does BB_0073 compare to other uncharacterized proteins in Borrelia species?

A comprehensive bioinformatic analysis of BB_0073 should include:

  • Sequence homology assessment: BLAST analysis against other Borrelia species to identify orthologs and paralogs.

  • Protein domain prediction: Using tools like InterPro, Pfam, and SMART to identify conserved domains or motifs.

  • Evolutionary analysis: Phylogenetic tree construction to visualize evolutionary relationships.

  • Comparative genomic context: Examining the genomic neighborhood of BB_0073 across Borrelia species for conserved gene arrangements.

Unlike proteins such as BB0365, which has a known structural fold similar to sodium-translocating oxidoreductase complex subunits , or BB0323, which contains a peptidoglycan-binding LysM motif , BB_0073 lacks clearly identified functional domains. This makes comparative analysis particularly important for generating functional hypotheses.

What can be inferred about BB_0073 function through comparative analysis with proteins of similar sequence or structure?

While specific structural information for BB_0073 is lacking, researchers could:

  • Use AlphaFold or other structure prediction tools to generate a predicted structure of BB_0073, similar to the approach used for BB0238 .

  • Perform structural similarity searches against the Protein Data Bank using predicted models.

  • Apply molecular dynamics simulations to explore potential binding pockets or functional sites.

This approach could yield insights similar to those gained for BB0238, where structural analysis revealed a helix-turn-helix motif implicated in protein-protein interactions .

What techniques are most effective for studying BB_0073's potential role in host-pathogen interactions?

Table 2: Advanced Techniques for Studying BB_0073 in Host-Pathogen Interactions

TechniqueApplicationAdvantagesLimitations
Transposon mutagenesisGenerate BB_0073 disruption mutantsUnbiased approach to assess gene functionMay be lethal if gene is essential
Tn-seqScreen for BB_0073 role in stress responseHigh-throughput, quantitativeRequires specialized expertise
Mouse-tick-mouse infection modelTest BB_0073 mutant infectivityAssesses function in natural infection cycleTime-consuming, requires animal facilities
Biolayer interferometryMeasure BB_0073 binding to host factorsReal-time, label-freeRequires purified proteins
CRISPRiControlled gene knockdownTunable repressionTechnical challenges in Borrelia

This type of comprehensive approach was successfully employed to identify genes involved in resistance to reactive oxygen and nitrogen species in B. burgdorferi and could be adapted to study BB_0073's potential contributions to pathogenesis.

How can researchers explore BB_0073's potential involvement in antibiotic resistance or bacterial persistence?

To investigate BB_0073's potential role in antibiotic resistance or persistence, researchers should consider:

  • Growth inhibition assays: Compare the antibiotic susceptibility of wild-type B. burgdorferi versus BB_0073 mutants.

  • Persister cell formation analysis: Assess whether BB_0073 affects formation of antibiotic-tolerant persister cells.

  • Stress response studies: Evaluate BB_0073 expression under antibiotic stress conditions.

  • In vivo persistence models: Test whether BB_0073 mutants show altered persistence in mouse models after antibiotic treatment.

  • Membrane permeability assays: If BB_0073 functions as a membrane protein, assess its impact on membrane permeability to antibiotics.

Similar approaches have been used to characterize other B. burgdorferi genes involved in stress responses, such as those identified through Tn-seq screens for reactive oxygen and nitrogen species resistance .

What are the methodological challenges in designing experiments to determine if BB_0073 coordinates metal ions similar to other Borrelia proteins?

Based on findings that BB0365 coordinates Zn²⁺ through specific histidine residues (His51, His55, His140) and that the aminopeptidase encoded by BB0069 is Zn²⁺-dependent , researchers investigating potential metal coordination by BB_0073 should address these methodological challenges:

  • Protein stability: Membrane proteins like BB_0073 often present stability challenges outside their native lipid environment. Optimization of detergent conditions is crucial.

  • Metal contamination: Experimental buffers must be metal-free to avoid false positives. EDTA treatment followed by extensive dialysis, as used for BB0069 , is recommended.

  • Detection sensitivity: Multiple complementary techniques should be employed:

    • ICP-MS for elemental analysis

    • ITC for binding thermodynamics

    • Spectroscopic methods (e.g., circular dichroism) to detect structural changes upon metal binding

  • Mutational analysis: If metal-binding is detected, site-directed mutagenesis of potential coordinating residues (histidines, cysteines, etc.) would be necessary to confirm the binding site.

  • Functional correlation: Establishing the relationship between metal binding and protein function through activity assays in the presence/absence of metals and chelators.

How might research on BB_0073 contribute to new therapeutic approaches for Lyme disease?

Research on BB_0073 could contribute to therapeutic development in several ways:

  • Vaccine development: If BB_0073 is exposed on the bacterial surface or essential for infection, it could represent a vaccine target. This approach would parallel research on outer surface proteins like BBA73 .

  • Drug target identification: If functional studies reveal that BB_0073 is essential for B. burgdorferi survival or virulence, it could be targeted for antimicrobial development.

  • Diagnostic applications: Knowledge of BB_0073's expression patterns and immunogenicity could inform the development of improved diagnostic tests for Lyme disease.

  • Understanding treatment failure: If BB_0073 contributes to antibiotic tolerance or immune evasion, it could help explain cases of persistent infection despite treatment.

The development of such applications would require thorough characterization of BB_0073's structure, function, and role in pathogenesis, similar to the approach taken with other essential proteins like BB0323 .

What experimental systems are most appropriate for assessing BB_0073's potential role throughout the Borrelia infection cycle?

To comprehensively assess BB_0073's role throughout the infection cycle, a combination of experimental systems is recommended:

  • In vitro culture systems: Compare BB_0073 expression and mutant phenotypes under conditions mimicking tick midgut (23°C, pH 7.6) versus mammalian host (37°C, pH 6.8).

  • Tick feeding model: Using artificial membrane feeding systems or infected ticks to assess BB_0073's role during tick feeding and transmission.

  • Mouse model of infection: The mouse-tick-mouse infection model, as used to study PlzA (BB0733) , provides the most comprehensive system to assess BB_0073's role throughout the natural infection cycle:

    • Needle inoculation of mice with wild-type versus BB_0073 mutant B. burgdorferi

    • Assessment of spirochete tissue distribution and immune response

    • Tick acquisition of spirochetes from infected mice

    • Transmission to naïve mice via infected ticks

  • Ex vivo systems: Using isolated primary cells (macrophages, dendritic cells) to assess host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.