Recombinant Borrelia burgdorferi Uncharacterized protein BB_0268 (BB_0268)

Shipped with Ice Packs
In Stock

Description

General Information

Borrelia burgdorferi is a bacterium that causes Lyme disease and encodes many conserved proteins with unknown structures and functions, some of which play essential roles in microbial infectivity . BB_0268 was initially annotated as a homolog of Hfq, an RNA-binding protein, but has been recharacterized as FlgV, a structural flagellar component that modulates flagellar assembly .

Function and Structure

BB_0268, now known as FlgV, is a broadly conserved gene found in the flagellar superoperon alongside σ28 in many Spirochaetes, Firmicutes, and other phyla, with distant homologs in Epsilonproteobacteria . FlgV is localized within flagellar motors and impacts the number and length of flagellar filaments . Borrelia burgdorferi lacking flgV construct fewer and shorter flagellar filaments and are defective in cell division and motility .

Role in Enzootic Cycle and Infection

During the enzootic cycle, B. burgdorferi lacking flgV can survive and replicate in Ixodes ticks, but they are attenuated for dissemination and infection in mice . This suggests that FlgV plays a crucial role in the late-stage flagellar assembly and is important for B. burgdorferi's dissemination during mouse infection .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BB_0268; Uncharacterized protein BB_0268; ORF36
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
BB_0268
Target Protein Sequence
MFISRELKYILLTSVSALFISAVLGLFCGLSFFTILVRSLLQFVFFFVIGLLIEYIFKKY LSNLFSTELSGNMENKPQDDKKSDKDFKENLDFQNKNSLYENSQNISSSGDFIEEVKKYK FETEDVSRGSDKNKKMSFIEDNDPKVVADAIKTLMSKKE
Uniprot No.

Target Background

Gene References Into Functions
  1. Hfq (bb0268) plays a crucial role in regulating pathogenicity factors. PMID: 20815822
Database Links

KEGG: bbu:BB_0268

STRING: 224326.BB_0268

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Where is FlgV (BB_0268) located within Borrelia burgdorferi cells?

Immunolocalization studies have demonstrated that FlgV (BB_0268) is primarily localized within the flagellar motors of Borrelia burgdorferi . This subcellular localization aligns with its functional role in flagellar assembly, providing strong evidence against previous hypotheses that it functioned as an RNA-binding protein in the cytoplasm.

How is the expression of BB_0268 regulated in Borrelia burgdorferi?

Northern analysis reveals that BB_0268 is expressed as part of multiple transcripts ranging in length from approximately 500 to 6,000 nucleotides across different growth phases . These transcripts include neighboring genes such as fapA (BB_0267), flhG (BB_0269), and flhB (BB_0272), indicating that BB_0268 is co-transcribed as part of larger operons involving other flagellar components .

What is the functional role of FlgV (BB_0268) in Borrelia burgdorferi?

FlgV functions as a structural flagellar component that modulates flagellar assembly in Borrelia burgdorferi. When the protein is absent, bacteria construct fewer and shorter flagellar filaments, resulting in defective cell division and reduced motility . This indicates that FlgV plays a crucial role in the proper assembly and function of the flagellar apparatus.

How can researchers experimentally assess the impact of FlgV on flagellar structure?

Researchers can generate FlgV-deficient Borrelia burgdorferi strains by replacing the BB_0268 ORF with an antibiotic resistance cassette (such as the streptomycin resistance gene aadA) . The resulting mutant strains can then be analyzed using electron microscopy to quantify flagellar number and measure flagellar filament length. Comparative analysis between wild-type and knockout strains enables precise determination of FlgV's contribution to flagellar structure.

What methods are effective for studying the protein-protein interactions of FlgV?

Co-immunoprecipitation (co-IP) experiments using C-terminal 3XFLAG tagged derivatives of BB_0268 expressed from the endogenous chromosomal location provide an effective approach . This method allows researchers to identify proteins that physically interact with FlgV. The experimental protocol should include appropriate controls (such as untagged wild-type strains) and verification of tagged protein expression through immunoblot analysis of cell lysate, supernatant, and elution samples.

How conserved is FlgV (BB_0268) across bacterial species?

FlgV is broadly conserved in the flagellar superoperon alongside σ28 in many bacterial phyla, including Spirochaetes and Firmicutes, with distant homologs also present in Epsilonproteobacteria . This widespread conservation suggests that FlgV performs a fundamentally important role in flagellar structure or function across diverse bacterial lineages.

What bioinformatic approaches can be used to identify FlgV homologs in other bacterial species?

Researchers can employ sequence similarity searches using tools like BLAST against comprehensive bacterial genome databases. Additionally, structural prediction algorithms can help identify functionally similar proteins despite low sequence conservation. When analyzing potential homologs, researchers should consider genomic context, particularly the proximity to other flagellar genes, as FlgV is typically located within flagellar operons .

How does the absence of FlgV affect Borrelia burgdorferi's ability to cause infection?

B. burgdorferi strains lacking FlgV can survive and replicate within Ixodes ticks but show significant attenuation in their ability to disseminate and establish infection in mice . This indicates that while FlgV is not essential for survival in the tick vector, it plays a critical role in mammalian host infection, particularly in the dissemination phase where bacterial motility is likely crucial.

What experimental models are most appropriate for studying FlgV's role in Borrelia burgdorferi infection dynamics?

The most comprehensive approach involves the complete enzootic cycle model, incorporating both the tick vector (Ixodes sp.) and mammalian host (typically mice) . This model allows researchers to assess the impact of FlgV at each stage of the Borrelia life cycle. In vitro motility assays complement these in vivo approaches by providing quantitative measurements of how FlgV affects bacterial movement in controlled conditions.

What are effective strategies for generating recombinant BB_0268 for in vitro studies?

For optimal expression and purification of recombinant BB_0268, researchers should consider the following methodological approach:

  • Express the protein in an Escherichia coli system using optimized codons for enhanced expression .

  • Include affinity tags (such as His-tag or FLAG-tag) to facilitate purification.

  • Employ a purification protocol involving metal affinity chromatography followed by size exclusion chromatography to ensure high purity.

  • Verify protein identity and integrity using mass spectrometry and Western blotting.

How can researchers assess the contradictory findings regarding BB_0268's RNA-binding capabilities?

To resolve contradictions between previous studies suggesting RNA-binding functions and newer evidence indicating a structural role, researchers should:

  • Conduct rigorous electrophoretic mobility shift assays with appropriate controls and physiologically relevant protein:RNA ratios (closer to ~15:1 molecules rather than the ~823:1 used in earlier studies) .

  • Perform comparative binding studies with known RNA-binding proteins like E. coli Hfq.

  • Use northern analysis to assess RNA profiles in BB_0268 knockout strains vs. wild-type.

  • Employ RNA immunoprecipitation followed by sequencing (RIP-seq) to identify any RNAs that might associate with BB_0268 in vivo.

What are the optimal methods for analyzing FlgV's impact on flagellar function and motility?

Advanced motility assessment requires a multi-faceted approach:

  • Tracking-based video microscopy to measure swimming speed, directional changes, and run-tumble patterns.

  • Swarm plate assays to assess population-level motility on semi-solid media.

  • Microfluidic devices to evaluate motility under controlled flow conditions and chemical gradients.

  • High-resolution electron microscopy (cryo-EM) to visualize structural differences in flagellar assemblies.

Could FlgV (BB_0268) be useful for serodiagnostic applications in Lyme disease testing?

Given the extensive research on various Borrelia burgdorferi proteins for serodiagnostic applications, it's valid to consider FlgV's potential utility. Based on studies of other Borrelia proteins, potential serodiagnostic applications would require:

  • Production of recombinant FlgV from multiple Borrelia genospecies (B. afzelii, B. burgdorferi sensu stricto, and B. garinii) to account for strain variation .

  • Assessment of reactivity with both IgG and IgM antibodies in patient sera using Western blot and ELISA techniques .

  • Determination of sensitivity and specificity values compared to established serodiagnostic antigens.

The table below shows how FlgV would need to be evaluated in comparison to other Borrelia proteins currently being investigated for serodiagnostic potential:

Recombinant ProteinSensitivity (n = 25)Specificity (n = 25)PPVNPVStatistical Significance (p < 0.05)
FlgV (hypothetical)Not yet determinedNot yet determined---
BB0108 BA48% (12/25)92% (2/25)86%64%Yes (p = 0.0036)
BB0108 BB40% (10/25)96% (1/25)91%62%Yes (p = 0.0046)
BB0108 BG44% (11/25)88% (3/25)79%61%Yes (p = 0.0255)
BB0323 BA44% (11/25)88% (3/25)79%61%Yes (p = 0.0255)
BB0323 BB36% (9/25)92% (2/25)82%59%Yes (p = 0.0374)
BB0323 BG44% (11/25)92% (2/25)85%62%Yes (p = 0.0083)

Note: FlgV values are hypothetical as this specific analysis has not been reported in the literature; other values represent actual data for comparison proteins.

What are the critical controls needed when studying FlgV function in Borrelia burgdorferi?

When designing experiments to study FlgV function, researchers should implement the following controls:

  • Wild-type (WT) Borrelia burgdorferi strains as positive controls .

  • FlgV genetic complementation strains to verify that observed phenotypes are specifically due to FlgV absence rather than polar effects or secondary mutations .

  • Growth curve measurements to ensure that any observed phenotypes are not due to general growth defects .

  • Strains with mutations in other flagellar genes to distinguish FlgV-specific effects from general flagellar defects.

How should researchers approach experimental design when testing hypotheses about FlgV function?

Researchers should follow systematic experimental design principles, including:

  • Clearly defining the independent variable (FlgV presence/absence or modification) and dependent variables (flagellar structure, motility, infection capability)3.

  • Controlling for confounding variables through appropriate experimental controls and randomization3 .

  • Determining appropriate sample sizes through power analysis to ensure statistical validity .

  • Using varied methodological approaches to test the same hypothesis, providing stronger evidence when consistent results are obtained across different methods .

What are the most promising research directions for further understanding FlgV function?

Future research should focus on:

  • Determining the precise molecular mechanism by which FlgV influences flagellar assembly.

  • Identifying the protein interactions of FlgV within the flagellar motor complex.

  • Investigating the potential of FlgV as a therapeutic target, given its importance for bacterial dissemination during infection.

  • Exploring the evolutionary relationship between FlgV and other flagellar proteins across diverse bacterial species.

How might advanced structural biology approaches contribute to understanding FlgV function?

Advanced structural biology techniques like cryo-electron microscopy, X-ray crystallography, and nuclear magnetic resonance spectroscopy could provide crucial insights into:

  • The three-dimensional structure of FlgV at atomic resolution.

  • The structural basis for FlgV's interaction with other flagellar components.

  • Potential conformational changes in FlgV during flagellar assembly and function.

  • Structure-based design of inhibitors that could disrupt FlgV function as potential therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.