Recombinant Borrelia burgdorferi Uncharacterized protein BB_0539 (BB_0539)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The protein is produced in E. coli using codon-optimized synthetic genes. Post-purification steps include affinity chromatography (Ni-NTA for His tag) and lyophilization for long-term stability . Reconstitution protocols recommend sterile deionized water with glycerol (5–50%) to prevent aggregation .

Critical Notes:

  • Avoid repeated freeze-thaw cycles to maintain structural integrity .

  • Functional assays require verification due to potential misfolding in prokaryotic systems .

Research Applications

While BB_0539’s role in B. burgdorferi biology is unclear, recombinant forms are used in:

  • Antigenicity Studies: Screening patient sera for Lyme disease antibodies .

  • Vaccine Development: As a candidate antigen in multi-epitope formulations .

  • Protein-Protein Interaction Analyses: Identifying binding partners using techniques like far-Western blotting .

Contextual Insights from Related Borrelial Proteins

Although BB_0539 itself lacks functional annotation, studies on homologous B. burgdorferi proteins provide clues:

Hypothetical Proteins with Essential Roles

  • BB0345: A chromosomally encoded hypothetical protein critical for survival in mammalian hosts. Mutants fail to persist in mice or grow in nutrient-deplete conditions, suggesting roles in stress adaptation .

  • BBI39 Paralogs: A family of outer membrane proteins (e.g., BBI36, BBI38) that are vaccine targets due to their surface exposure and immune recognition .

These parallels suggest BB_0539 could participate in:

  • Metabolic adaptation during host-vector transitions.

  • Immune evasion via cryptic epitope masking .

Knowledge Gaps and Future Directions

No direct functional studies on BB_0539 exist, highlighting key research needs:

  1. Localization Studies: Determine if BB_0539 is membrane-associated or cytoplasmic using proteinase K assays .

  2. Genetic Knockout Models: Assess infectivity defects in B. burgdorferi lacking BB_0539 .

  3. Structural Resolution: Solve its 3D structure to identify potential DNA/ligand-binding domains .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BB_0539; Uncharacterized protein BB_0539
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
BB_0539
Target Protein Sequence
MIDLTQEKQEILIKNKFLAKVFGLMSIGLLISAVFAYATSENQTIKAIIFSNSMSFMAMI LIQFGLVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGITAGTF LGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVVIFTGLTA YDVQNISKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRND
Uniprot No.

Target Background

Database Links

KEGG: bbu:BB_0539

STRING: 224326.BB_0539

Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What experimental systems are available for studying BB_0539?

To study BB_0539, researchers can use several experimental approaches:

  • Recombinant protein expression: The protein can be expressed in E. coli with affinity tags (typically His-tag) for purification. This approach allows for biochemical and structural studies .

  • In vivo expression systems: BB_0539 can be studied in its native context using the dialysis membrane chamber (DMC) cultivation system, which simulates mammalian host conditions .

  • Gene expression analysis: qRT-PCR and RNA-seq methods have been employed to study regulation of BB_0539 under different conditions .

  • Genetic manipulation: Recent advances in Borrelia genetic tools allow for targeted gene deletion, complementation, and modification .

To maximize experimental reproducibility, culture conditions must be carefully controlled, as Borrelia gene expression is highly sensitive to environmental factors including temperature, pH, and nutrient availability .

How should experimental controls be designed when studying BB_0539 expression patterns?

When designing experiments to study BB_0539 expression, multiple controls should be implemented:

Table 1: Essential Controls for BB_0539 Expression Studies

Control TypePurposeImplementation
Temperature controlDistinguish host-specific from temperature-dependent regulationCompare 23°C to 37°C in vitro cultures alongside in vivo or DMC samples
Constitutive gene controlNormalize expression dataUse flaB (BB_0147) or other stable reference genes for qRT-PCR
Empty vector controlAccount for vector effects in recombinant studiesExpress vector backbone without BB_0539 insert
Negative tissue controlControl for host tissue backgroundInclude uninfected tissue samples processed identically to infected samples
Time-course controlAccount for temporal expression changesSample at multiple time points post-infection

The primary challenge in Borrelia research is distinguishing which gene expression changes are specifically due to host adaptation versus simple temperature shifts. The dialysis membrane chamber (DMC) cultivation system allows researchers to separate these variables by exposing spirochetes to mammalian host factors while controlling temperature .

What experimental design would be optimal for determining the subcellular localization of BB_0539?

To determine the subcellular localization of BB_0539, a comprehensive approach combining multiple techniques is recommended:

  • Computational prediction: Analysis of the amino acid sequence suggests BB_0539 may be a membrane protein based on its hydrophobicity profile.

  • Fractionation studies: Implement a systematic approach including:

    • Triton X-114 phase partitioning to separate membrane from soluble proteins

    • Proteinase K accessibility assay to determine surface exposure

    • Salt and detergent extraction to assess membrane integration strength

  • Immunolocalization: Generate specific antibodies against BB_0539 and use immunofluorescence microscopy or immunoelectron microscopy to visualize its location.

  • Reporter fusion systems: Create translational fusions with reporter proteins such as GFP, ensuring the fusion doesn't disrupt targeting signals.

The method used by Brooks et al. for BBI39 localization studies provides an excellent template, as it combines multiple complementary approaches to establish subcellular location with high confidence .

What does the expression profile of BB_0539 during infection suggest about its function?

Transcriptome analysis of BB_0539 expression reveals important insights about its potential function:

In a study examining doxycycline effects on B. burgdorferi, BB_0539 was found to be down-regulated with a log2 fold change of -2.051 (p-value 0.002) in treated versus control samples . This significant down-regulation suggests BB_0539 may be part of the adaptive response to antibiotic stress.

Table 2: BB_0539 Differential Expression Under Various Conditions

Experimental ConditionLog2 Fold Changep-valueStatistical SignificanceReference
Doxycycline treatment-2.0510.002Significant
DMC vs. in vitro cultureDifferentially expressed*<0.05Significant
Tick vs. mammalian hostNot determined---

*Specific fold change values were not provided in the available data

Given that many membrane proteins in B. burgdorferi show environment-specific expression patterns, the regulation of BB_0539 in response to doxycycline suggests it may play a role in cell envelope integrity, transport functions, or stress response. The protein's expression profile resembles that of other membrane proteins that are down-regulated during specific phases of the infection cycle .

How can contradictory experimental results regarding BB_0539 function be reconciled?

When researchers encounter contradictory results regarding BB_0539 function, systematic troubleshooting should follow these steps:

  • Evaluate experimental conditions: B. burgdorferi shows remarkable phenotypic plasticity. Minor variations in culture conditions (passage number, growth phase, medium composition) can significantly alter gene expression.

  • Consider strain differences: Compare results across different B. burgdorferi isolates. The genome harbors numerous paralogous gene families with varying expression patterns between strains.

  • Examine methodological differences: Different detection methods (RNA-seq, qRT-PCR, proteomics) may yield apparently contradictory results due to post-transcriptional regulation.

  • Integrate multi-omics data: Combining transcriptomic, proteomic, and functional data often resolves apparent contradictions by revealing regulatory complexity.

For example, researchers studying hypothetical proteins in C. difficile (which presents similar challenges to B. burgdorferi research) have found that subcellular localization prediction tools can yield conflicting results. In these cases, experimental validation is essential, with approximately 32-38% of hypothetical proteins localizing to the cytoplasm and 23-27% to the cytoplasmic membrane .

What structural bioinformatics approaches are most useful for generating hypotheses about BB_0539 function?

For uncharacterized proteins like BB_0539, structural bioinformatics provides crucial insights:

  • Homology modeling: While BB_0539 lacks characterized homologs with solved structures, threading approaches can identify structural similarities to proteins with known functions despite low sequence identity.

  • Conserved domain analysis: Tools like NCBI's CDD search can identify functional motifs. For Borrelia hypothetical proteins, recurring domains include HDC_protein, M34_PPEP, PBECR3, and SPASM domains, which may provide clues to function .

  • Structural prediction using AI-based tools: Recent advances in AI-based structure prediction (e.g., AlphaFold2) can generate highly accurate structural models even for proteins with limited homology to known structures.

  • Binding site prediction: Computational analysis of surface properties and conservation patterns can predict potential ligand binding sites or protein-protein interaction interfaces.

  • Molecular dynamics simulations: These can provide insights into potential conformational changes and functional mechanisms.

For BB_0539, its multiple predicted transmembrane regions suggest it may function as a transporter or signaling protein embedded in the bacterial membrane, potentially involved in host-pathogen interactions.

What are the critical factors for optimizing recombinant BB_0539 expression and purification?

Successful expression and purification of recombinant BB_0539 requires careful optimization:

Expression system selection:

  • E. coli is the most common system for Borrelia protein expression

  • For membrane proteins like BB_0539, specialized strains (C41/C43(DE3), Lemo21) typically yield better results

  • Consider using solubility-enhancing fusion partners (SUMO, MBP, TrxA)

Expression conditions:

  • Lower temperatures (16-20°C) often improve folding of membrane proteins

  • Inducer concentration should be optimized (0.1-0.5 mM IPTG typically)

  • Extended expression times (16-24 hours) at reduced temperatures

Purification strategy:

  • Membrane extraction using appropriate detergents (DDM, LDAO, or FC-12)

  • IMAC purification using His-tag

  • Size exclusion chromatography for final polishing

Buffer optimization:

  • Include stabilizing agents (glycerol 10-20%)

  • Test multiple pH conditions (typically pH 7.5-8.5)

  • Consider lipid supplementation for membrane protein stability

Storage of purified BB_0539 should include 50% glycerol and aliquoting to avoid freeze-thaw cycles, with storage at -80°C for extended periods .

How can researchers design effective immunization studies to evaluate BB_0539 as a vaccine candidate?

To evaluate BB_0539 as a vaccine candidate, researchers should follow these methodological guidelines:

  • Antigen preparation:

    • Use full-length recombinant protein or immunogenic peptides

    • Ensure proper folding of recombinant protein

    • Consider adjuvant selection based on desired immune response type

  • Animal model selection:

    • C3H/HeN mice are commonly used for Borrelia vaccine studies

    • Consider both needle inoculation and tick challenge models

  • Immunization schedule:

    • Primary immunization followed by 2-3 booster doses

    • Collect serum samples to monitor antibody development by ELISA

  • Challenge experiments:

    • Challenge with infected nymphs (5 ticks/mouse)

    • Alternative: needle inoculation with cultured spirochetes (10^5 cells/mouse)

  • Evaluation parameters:

    • Measure bacterial burden in tissues by qRT-PCR

    • Culture spirochetes from skin and heart tissues

    • Assess pathogen acquisition by feeding naive ticks on immunized mice

    • Quantify pathogen in ticks by qRT-PCR

A similar approach has been successfully employed for evaluating the vaccine potential of BBI39 paralogs, which demonstrated efficacy in reducing pathogen acquisition by the vector, transmission to hosts, and induction of disease .

What data table design best presents BB_0539 experimental results to facilitate comparative analysis?

Effective data presentation is crucial for comparative analysis. For BB_0539 research, consider these table design principles:

Table 3: Recommended Data Table Design for BB_0539 Experimental Results

Design ElementImplementationRationale
TitleClear statement of purpose (e.g., "Effect of [treatment] on BB_0539 expression")Immediately conveys the experiment's focus
Independent variableLeft column (e.g., experimental conditions, time points)Follows standard scientific practice
Dependent variableSubsequent columns with clear unitsMaintains clarity in measurement reporting
ReplicatesInclude multiple trial columnsDemonstrates experimental reproducibility
Derived valuesRight-most column (e.g., averages, statistical significance)Facilitates interpretation of results
UnitsAlways include in column headersEnsures data interpretability
Sample sizeInclude in footnote or methods referenceEnables statistical power assessment

When presenting gene expression data for BB_0539, include both absolute values and fold changes relative to control conditions. For comparative genomics, include data from multiple Borrelia strains and highlight sequence conservation or variation in functional domains.

This approach, exemplified in the data presentation for other B. burgdorferi genes in the literature, ensures that your results can be meaningfully compared with findings from other research groups .

How can functional genomics approaches be applied to determine the role of BB_0539 in Borrelia pathogenesis?

To elucidate BB_0539's role in pathogenesis, researchers should consider these functional genomics approaches:

  • Gene knockout and complementation:

    • Generate BB_0539 deletion mutants

    • Create complemented strains with wild-type BB_0539

    • Assess phenotypes in vitro and in vivo

  • Transcriptome analysis:

    • Compare global gene expression between wild-type and BB_0539 mutants

    • Identify gene networks affected by BB_0539 deletion

  • Protein interactome mapping:

    • Identify BB_0539 protein interaction partners using pull-down assays

    • Perform crosslinking studies to capture transient interactions

    • Validate interactions with co-immunoprecipitation

  • Host response studies:

    • Examine host immune responses to wild-type vs. BB_0539 mutants

    • Measure inflammatory mediators in infected tissues

  • Comparative genomics:

    • Analyze BB_0539 conservation across Borrelia species and strains

    • Identify sequence variations correlating with pathogenicity

This multi-faceted approach will provide complementary data to construct a comprehensive understanding of BB_0539's role. Similar approaches have successfully characterized previously uncharacterized proteins in B. burgdorferi and other bacterial pathogens .

What novel analytical techniques can help resolve the function of membrane-associated uncharacterized proteins like BB_0539?

Emerging technologies offer new opportunities for characterizing proteins like BB_0539:

  • Cryo-electron microscopy: Can resolve membrane protein structures at near-atomic resolution without crystallization, particularly valuable for proteins resistant to crystallization.

  • Native mass spectrometry: Enables analysis of intact membrane protein complexes, providing insights into oligomeric states and interactions.

  • Single-molecule tracking: Allows visualization of protein dynamics and localization in living bacteria, revealing functional information not accessible through static methods.

  • CRISPR interference (CRISPRi): Permits tunable repression of gene expression, enabling study of essential genes where knockouts are lethal.

  • Ribosome profiling: Provides genome-wide information on translation, revealing post-transcriptional regulation not captured by transcriptomics.

  • Metabolomics integration: Correlates changes in metabolite profiles with protein function, particularly useful for identifying transporter substrates.

  • Advanced bioinformatics: Utilizes evolutionary coupling analysis and co-expression networks to predict functional relationships.

These approaches have already begun to illuminate the functions of previously uncharacterized proteins in bacterial systems, and their application to BB_0539 would likely yield valuable insights into its role in Borrelia biology and pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.