Recombinant Borrelia burgdorferi UPF0073 membrane protein BB_0117 (BB_0117)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
BB_0117; UPF0073 membrane protein BB_0117
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
BB_0117
Target Protein Sequence
MLRENKLKNYSLSDVNTSKIPKNELFSSISHLFGIILSIIGTTILVTISTLKKKDLHVVV FLIYGFSMTLLYVMSTLYHIFPKGSKIKKIFRKFDHISIFILIAGTYTPACAILVPNKSG LIILCIVWSLAIIGIIFKIIFTNSPGWFNGSIFIIMGWIIIFKIKPIYKALSGKGFFWLV FGGIVYTIGGIVYILSKKFNPTINMKMHDVFHILIIIASASHFWLMLKYISNF
Uniprot No.

Target Background

Database Links

KEGG: bbu:BB_0117

STRING: 224326.BB_0117

Protein Families
UPF0073 (Hly-III) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is BB_0117 protein expression regulated in B. burgdorferi during different environmental conditions?

Expression of many B. burgdorferi membrane proteins is regulated by temperature and pH shifts that mimic the transition from tick vector to mammalian host. While specific data for BB_0117 regulation is limited in the provided sources, similar membrane proteins like BB0172 demonstrate upregulation during temperature shifts from RT to 37°C and pH changes to 6.8, conditions that simulate the tick-to-mammal transition. This temperature-dependent expression pattern is consistent with many virulence factors and membrane proteins in B. burgdorferi that play roles during mammalian infection .

Research approaches to study this regulation typically involve quantitative RT-PCR under various environmental conditions (temperature, pH, oxygen tension), western blot analysis of protein expression, and promoter reporter assays to identify regulatory elements controlling BB_0117 expression.

What is the cellular localization of BB_0117 and how can researchers experimentally verify its membrane topology?

BB_0117 is classified as a membrane protein in B. burgdorferi. To experimentally verify its cellular localization and topology, researchers can employ multiple complementary approaches:

  • Proteinase K accessibility assay: Surface-exposed proteins are sensitive to proteinase K digestion when intact cells are treated, while internal proteins remain protected. This method has been successfully used with other B. burgdorferi membrane proteins to determine surface exposure .

  • Triton X-114 phase partitioning: This technique separates hydrophobic membrane proteins from water-soluble proteins, helping to confirm membrane association .

  • Immunofluorescence assay and immunoelectron microscopy: These techniques can visualize the location of BB_0117 in intact cells when specific antibodies are available .

  • Membrane fractionation: Differential centrifugation and separation of outer and inner membrane fractions can determine in which membrane the protein resides.

What are the optimal conditions for recombinant expression and purification of BB_0117 protein?

Recombinant BB_0117 can be successfully expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. Based on available data, the following protocol is recommended:

Expression system:

  • E. coli strain optimized for membrane protein expression

  • Vector containing full-length BB_0117 (1-233aa) fused to N-terminal His tag

  • IPTG-inducible promoter system

Purification protocol:

  • Grow transformed E. coli to mid-log phase

  • Induce with IPTG (concentration optimized for your specific system)

  • Harvest cells and disrupt by sonication or French press

  • Solubilize membrane fraction using appropriate detergent

  • Purify using Ni-NTA affinity chromatography

  • Consider buffer optimization with 6% trehalose and Tris/PBS-based buffer (pH 8.0) for stability

Storage recommendations:

  • Lyophilized powder for long-term storage

  • Reconstitute in deionized water to 0.1-1.0 mg/mL

  • Add glycerol to 50% final concentration for storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

How can researchers design experiments to identify potential binding partners and functions of BB_0117?

To elucidate the functional role of BB_0117, researchers should consider a multi-faceted experimental approach:

  • Yeast two-hybrid or bacterial two-hybrid screening:

    • Use BB_0117 as bait to screen B. burgdorferi genomic DNA library or host protein libraries

    • Validate interactions with co-immunoprecipitation or pull-down assays

  • Cross-linking studies with mass spectrometry:

    • Use chemical cross-linkers to stabilize transient protein-protein interactions

    • Identify binding partners through LC-MS/MS analysis

  • Gene knockout/knockdown studies:

    • Generate BB_0117 deletion mutants using homologous recombination

    • Compare phenotypes to wild-type B. burgdorferi for changes in morphology, growth, and virulence

    • Complement the mutant to confirm phenotype is due to BB_0117 loss

  • Binding assays with host components:

    • Test binding to extracellular matrix components and host cells

    • Determine if binding is metal ion-dependent (similar to BB0172, which has a metal ion-dependent adhesion site)

  • Structural studies:

    • X-ray crystallography or NMR to determine protein structure

    • Identify potential functional domains through structure-based analysis

What controls should be incorporated in protease sensitivity assays when studying BB_0117 surface exposure?

When conducting protease sensitivity assays to determine BB_0117 surface exposure on B. burgdorferi, the following controls are essential:

  • Positive control: Include a well-characterized surface-exposed protein (e.g., OspA) that should be degraded by proteinase K.

  • Negative control: Include a known periplasmic or cytoplasmic protein that should be protected from proteinase K digestion when cells are intact.

  • Cell integrity control: Monitor a periplasmic marker protein to ensure proteinase K treatment does not compromise membrane integrity, which would lead to false positives.

  • Protease activity control: Include samples with heat-inactivated proteinase K to verify that protein degradation is specifically due to protease activity.

  • Concentration gradient: Test multiple proteinase K concentrations to establish dose-dependent degradation patterns.

  • Western blot controls: Include recombinant BB_0117 as a positive control for antibody specificity.

  • Internal digestion control: Perform parallel experiments with detergent-permeabilized cells to confirm that BB_0117 is indeed susceptible to proteinase K when accessible .

How does BB_0117 contribute to B. burgdorferi virulence and host-pathogen interactions?

While specific data on BB_0117's role in virulence is limited in the provided sources, we can outline research approaches to investigate this question:

  • Animal infection studies:

    • Compare infection rates, bacterial loads, and disease progression between wild-type and BB_0117 knockout strains

    • Examine tissue tropism changes when BB_0117 is absent or mutated

  • Immune response analysis:

    • Evaluate host immune response to BB_0117 during infection

    • Determine if BB_0117 antibodies are protective in animal models

  • Host cell interaction assays:

    • Investigate BB_0117's role in adhesion to host cells or tissues

    • Assess if BB_0117 affects internalization or intracellular survival

  • Comparative analysis with related proteins:

    • Study BB_0117 in context of other membrane proteins like P13, which is immunogenic and surface-exposed

    • Determine if BB_0117 belongs to a protein family with redundant functions

  • Transcriptome analysis:

    • Compare gene expression patterns between wild-type and BB_0117 mutant strains

    • Identify pathways affected by BB_0117 disruption

What evidence exists for posttranslational modifications of BB_0117 and how might these affect its function?

Membrane proteins in B. burgdorferi, such as P13, often undergo posttranslational processing at both N- and C-termini, which can significantly impact their localization and function . For BB_0117, researchers should investigate:

  • N-terminal processing:

    • The protein sequence suggests a potential signal peptidase type I cleavage site

    • Experimental verification through N-terminal sequencing of native protein compared to the recombinant full-length form

  • C-terminal modifications:

    • Mass spectrometry analysis of native BB_0117 to detect C-terminal processing

    • Comparison between predicted and actual molecular weight

  • Lipidation:

    • Analysis for lipid modifications that could anchor the protein to the membrane

    • Metabolic labeling with radioactive fatty acids to detect lipidation

  • Other modifications:

    • Phosphorylation, glycosylation, or other modifications that might regulate function

    • Use of modification-specific antibodies or mass spectrometry techniques

  • Functional impact assessment:

    • Create recombinant versions lacking specific modification sites

    • Compare functional activities between modified and unmodified forms

Understanding these modifications is crucial as they may affect protein stability, localization, antigenicity, and binding interactions with host components.

What experimental design approaches are most effective for evaluating BB_0117 as a potential vaccine candidate?

Evaluating BB_0117 as a vaccine candidate requires a systematic experimental approach:

  • Antigenicity assessment:

    • Determine immunogenicity in animal models

    • Analyze antibody response specificity and titer

    • Evaluate T-cell responses to BB_0117 epitopes

  • Protection studies:

    • Immunize animals with recombinant BB_0117

    • Challenge with live B. burgdorferi

    • Measure protection by quantifying bacterial load, dissemination, and disease symptoms

    • Include control groups with adjuvant only and established antigens

  • Epitope mapping:

    • Identify protective B-cell and T-cell epitopes

    • Create epitope-based vaccines with improved safety profiles

  • Cross-protection analysis:

    • Test protection against different B. burgdorferi strains and species

    • Evaluate conservation of BB_0117 among pathogenic Borrelia species

  • Delivery system optimization:

    • Compare different adjuvants and delivery systems

    • Test DNA vaccines, protein subunits, and peptide-based approaches

  • Safety evaluation:

    • Monitor for autoimmune responses

    • Assess for enhancement of disease in some conditions

This experimental design follows the basic scientific method: observation (BB_0117 is immunogenic), hypothesis (BB_0117 vaccination provides protection), prediction (immunized animals will have reduced infection/disease), and testing (challenge studies with proper controls)3.

How can researchers resolve contradictory data when studying BB_0117 membrane topology and orientation?

When facing contradictory results regarding BB_0117 membrane topology and orientation, researchers should implement a systematic troubleshooting approach:

  • Employ multiple complementary methods:

    • Combine computational predictions with at least three different experimental approaches

    • Use both in vivo methods (e.g., protease accessibility) and in vitro methods (e.g., liposome reconstitution)

  • Consider strain-specific differences:

    • Test BB_0117 in multiple B. burgdorferi strains or isolates

    • Sequence BB_0117 from different strains to identify polymorphisms that might affect topology

  • Evaluate experimental conditions:

    • Test if growth conditions affect protein conformation or expression

    • Consider if in vitro expression systems accurately reflect native conformation

  • Generate topology reporter fusions:

    • Create fusion proteins with reporters at different positions

    • PhoA fusions are active in periplasm, while GFP is fluorescent in cytoplasm

  • Use site-directed cysteine labeling:

    • Introduce cysteines at predicted loop regions

    • Test accessibility with membrane-impermeable sulfhydryl reagents

  • Control for protein dynamics:

    • Consider if the protein undergoes conformational changes

    • Test if certain domains become accessible only under specific conditions

  • Statistical analysis of reproducibility:

    • Perform multiple independent experiments

    • Quantify results and apply appropriate statistical tests

    • Report confidence intervals for all measurements

This approach follows the experimental method principle of isolating variables and comparing control vs. experimental conditions to determine causality3.

How does BB_0117 differ from other membrane proteins in the B. burgdorferi proteome?

BB_0117 is classified as a UPF0073 family membrane protein, which distinguishes it from other characterized B. burgdorferi membrane proteins. A comparative analysis reveals:

  • Structural differences:

    • Unlike OspA-D lipoproteins, BB_0117 appears to be an integral membrane protein with predicted transmembrane domains

    • In contrast to BB0172, which contains a von Willebrand factor A (vWFA) domain with a metal ion-dependent adhesion site (MIDAS) motif, BB_0117 lacks these specific functional domains

  • Conservation and gene family:

    • BB_0117 may belong to a gene family similar to P13, which has five additional members in B. burgdorferi sensu stricto

    • Comparative genomic analysis across Borrelia species could reveal conservation patterns

  • Expression patterns:

    • Different from OspA and OspB, which are highly expressed during tick stages

    • May have distinct temperature and pH-dependent regulation compared to other membrane proteins

  • Immunogenicity profile:

    • Has a potentially unique antigenic profile compared to well-characterized outer surface proteins

    • May be masked by dominant antigens like OspA-D in wild-type cells

  • Functional roles:

    • May serve specialized functions in membrane integrity, transport, or host interaction

    • Could have complementary or redundant functions with other membrane proteins

What bioinformatic approaches can help predict the function of BB_0117 based on its sequence and structural features?

Researchers can employ various bioinformatic tools and approaches to predict BB_0117 function:

  • Sequence homology analysis:

    • BLAST searches against protein databases

    • Multiple sequence alignment with homologs from other bacterial species

    • Phylogenetic analysis to trace evolutionary relationships

  • Domain and motif prediction:

    • InterPro, SMART, or Pfam searches to identify conserved domains

    • Motif identification for functional sites (e.g., binding motifs, catalytic sites)

    • Signal peptide prediction using SignalP

  • Structural prediction:

    • Secondary structure prediction (PSIPRED, JPred)

    • Transmembrane topology prediction (TMHMM, Phobius)

    • 3D structure modeling using AlphaFold2 or I-TASSER

    • Molecular dynamics simulations to predict conformational changes

  • Functional inference:

    • Gene neighborhood analysis to identify operons or functionally related genes

    • Co-expression network analysis using transcriptomic data

    • Protein-protein interaction prediction (STRING database)

  • Integrative approaches:

    • Combine multiple lines of evidence in a Bayesian framework

    • Use supervised machine learning trained on proteins with known functions

    • Cross-reference with phenotypic data from related bacteria

The results from these analyses should guide experimental design by generating testable hypotheses about BB_0117 function in B. burgdorferi biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.