Recombinant Borrelia burgdorferi UPF0092 membrane protein BB_0651 (BB_0651)

What is Borrelia burgdorferi UPF0092 membrane protein BB_0651?

Borrelia burgdorferi UPF0092 membrane protein BB_0651 is a 105 amino acid protein encoded by the BB_0651 gene in Borrelia burgdorferi, the causative agent of Lyme disease. The protein is part of the UPF0092 protein family and is localized to the bacterial membrane. The full amino acid sequence is MYSMGGFVFLLQEFSGNSSFLRSLLVFVPVIAIFWFLVISPQRKEEKNKKEMIKNLKKGDKVLTIGGIFGVVKKLGDTDVILELSPNNEAVFIKNSIDKVLSEKK, with a Uniprot accession number of O51595 . This protein is found specifically in Borrelia burgdorferi strain ATCC 35210 / B31 / CIP 102532 / DSM 4680, which is a commonly used reference strain in laboratory research .

What are the optimal storage conditions for recombinant BB_0651 protein?

Recombinant BB_0651 protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability . For short-term storage (up to one week), working aliquots can be kept at 4°C. For extended storage periods, the protein should be stored at -20°C or -80°C to prevent degradation . It is not recommended to subject the protein to repeated freeze-thaw cycles, as this can significantly reduce its activity and structural integrity. Instead, researchers should prepare small working aliquots for regular use while keeping the main stock frozen.

How does BB_0651 relate to other Borrelia proteins in Lyme disease research?

BB_0651 is one of many membrane proteins expressed by Borrelia burgdorferi, which is one of twelve Borrelia species known to cause Lyme disease or borreliosis . While more extensively studied outer surface proteins like OspA and OspB (BB_A15 and BB_A16 respectively) have been the focus of much Lyme disease research, membrane proteins like BB_0651 may play important roles in bacterial physiology and pathogenesis . Research into BB_0651 contributes to the broader understanding of Borrelia membrane biology, which is crucial for developing new therapeutic approaches against Lyme disease.

What are the recommended methods for analyzing BB_0651 expression under different environmental conditions?

For analyzing BB_0651 expression under different environmental conditions, RNA sequencing (RNA-Seq) is the gold standard methodology. Based on established protocols for Borrelia gene expression analysis, researchers should:

• Culture B. burgdorferi under the desired experimental conditions (e.g., different temperatures, pH levels, or antibiotic treatments)

• Harvest cells by centrifugation (typically 15 min at 8200×G at 4°C)

• Extract total RNA using commercial kits designed for bacterial RNA isolation

• Verify RNA quality using systems like the Agilent 2100 Bioanalyzer, targeting a 23S/16S rRNA ratio of approximately 1 for high-quality RNA

• Remove contaminating DNA using DNase I treatment

• Prepare cDNA libraries and perform RNA sequencing

• Analyze differential expression using bioinformatics tools such as Trimmomatic for adapter removal, Salmon for read alignment, and DEseq2 for differential expression analysis

Genes showing log2(fold change) ≥ 1 or ≤ -1 with adjusted p-values ≤ 0.05 and basemean > 20 are typically considered significantly differentially expressed .

How can researchers design experiments to investigate BB_0651 function in relation to neighboring genes?

To investigate BB_0651 function in relation to neighboring genes like BB_0650, researchers should consider the following experimental design approach:

• Perform genomic context analysis to identify potential operon structures or functional relationships

• Conduct co-expression analysis under various conditions to determine if BB_0651 and neighboring genes (particularly BB_0650) show correlated expression patterns

• Generate single and double gene knockout mutants using established genetic manipulation techniques for Borrelia

• Perform phenotypic characterization of the mutants, including growth rate assessment, morphological analysis, and stress response evaluation

• Complement gene deletions to confirm phenotypes are specifically related to the targeted genes

• Use protein-protein interaction methods such as bacterial two-hybrid systems or co-immunoprecipitation to identify direct interactions between BB_0651 and products of neighboring genes

Based on available data, BB_0650 (a hypothetical protein) showed significant differential expression under doxycycline treatment in B. burgdorferi, with a log2(fold change) of -1.20 at 3 hours and 1.58 at 24 hours . This suggests potential coordinated regulation with BB_0651 that warrants further investigation.

What techniques are most effective for studying the membrane topology and structure of BB_0651?

For studying the membrane topology and structure of BB_0651, the following techniques are most effective:

• Computational prediction: Begin with in silico analysis using prediction algorithms like TMHMM, HMMTOP, or Phobius to predict transmembrane domains and topology

• Cysteine scanning mutagenesis: Systematically replace residues with cysteine and probe accessibility with membrane-permeable and impermeable sulfhydryl reagents

• Fusion protein approaches: Create fusions with reporter proteins like alkaline phosphatase (PhoA) or green fluorescent protein (GFP) at various positions to determine orientation relative to the membrane

• Protease protection assays: Treat intact cells or membrane vesicles with proteases to identify regions accessible from the extracellular environment

• Structural determination: For high-resolution structural information, pursue X-ray crystallography or cryo-electron microscopy (cryo-EM) after optimizing protein purification

• NMR spectroscopy: For determining dynamic aspects of protein structure in membrane-mimetic environments

Given the relatively small size of BB_0651 (105 amino acids) and its hydrophobic character suggested by the amino acid sequence (containing stretches like "FVFLLQE" and "VFVPVIAIFWFLV"), it likely contains transmembrane domains that would benefit from these analytical approaches .

What are the critical parameters for optimizing recombinant BB_0651 expression and purification?

For optimizing recombinant BB_0651 expression and purification, researchers should focus on the following critical parameters:

• Expression system selection: While E. coli is commonly used, membrane proteins often benefit from specialized strains like C41(DE3) or C43(DE3) designed for toxic or membrane protein expression

• Induction conditions: Optimize temperature (typically 16-30°C), inducer concentration, and duration to balance protein yield with proper folding

• Solubilization: Test multiple detergents (e.g., DDM, LDAO, OG) at various concentrations for efficient membrane extraction while maintaining protein stability

• Purification strategy: Implement multi-step purification including:

  • Affinity chromatography (typically utilizing a His-tag)

  • Size exclusion chromatography to separate aggregates and contaminants

  • Ion exchange chromatography if necessary for removing remaining impurities

• Buffer optimization: Screen various buffers, pH conditions, and additives (glycerol, specific ions) to enhance protein stability

• Quality control: Assess protein purity by SDS-PAGE, homogeneity by dynamic light scattering, and structural integrity by circular dichroism

The presence of multiple hydrophobic regions in BB_0651's sequence makes detergent selection particularly critical. For storage, a Tris-based buffer with 50% glycerol has been established as effective .

How can researchers effectively design functional assays for BB_0651?

Designing effective functional assays for BB_0651 requires a methodical approach:

• Hypothesize function based on bioinformatic analysis:

  • Search for conserved domains or motifs in the sequence

  • Identify homologs with known functions

  • Analyze genomic context and co-expression patterns

• Develop targeted assays based on predicted functions:

  • For transport functions: liposome reconstitution with fluorescent substrates

  • For enzymatic activity: substrate conversion assays with purified protein

  • For signaling: protein-protein interaction studies with potential partners

• Genetic approaches:

  • Generate knockout or conditional mutants in B. burgdorferi

  • Perform complementation studies

  • Conduct transcriptomic and proteomic analyses of mutants vs. wild-type

• Environmental response testing:

  • Assess expression and localization under different conditions (pH, temperature, nutrient availability)

  • Test phenotypes under conditions that mimic tick vector and mammalian host environments

• In vivo relevance:

  • Evaluate the impact of mutation on virulence in mouse models

  • Assess infectivity and persistence in tick-mouse transmission models

When developing these assays, researchers should consider that BB_0651 is located near genes involved in stress response pathways, as suggested by the differential expression of neighboring genes under antibiotic stress .

What bioinformatic approaches are recommended for analyzing BB_0651 homologs across Borrelia species?

For comprehensive analysis of BB_0651 homologs across Borrelia species, researchers should implement the following bioinformatic approaches:

• Sequence-based analyses:

  • Perform BLAST searches against Borrelia genomes to identify homologs

  • Conduct multiple sequence alignment using MUSCLE or CLUSTAL

  • Generate phylogenetic trees using maximum likelihood or Bayesian methods

  • Calculate sequence conservation metrics to identify functionally critical residues

• Structural predictions:

  • Apply homology modeling if structural templates exist

  • Use ab initio modeling approaches for novel fold prediction

  • Predict secondary structure elements and transmembrane regions

  • Identify potential functional sites through structural analysis

• Genomic context analysis:

  • Compare gene neighborhoods across different Borrelia species

  • Identify conserved operonic structures that may indicate functional relationships

  • Analyze promoter regions for conserved regulatory elements

• Functional annotation transfer:

  • Use COG, KEGG, and GO analyses to predict functional categories

  • Apply protein domain recognition tools like PFAM and InterPro

  • Utilize tools like STRING to predict functional associations

• Evolutionary analysis:

  • Calculate selection pressures (dN/dS ratios) to identify sites under positive or purifying selection

  • Perform coevolution analysis to identify functionally linked residues

This multi-faceted approach will provide insights into BB_0651's evolutionary history and potential functional conservation across the 52 known Borrelia species, including the 12 species known to cause Lyme disease .

How should researchers interpret BB_0651 expression changes in response to environmental stressors?

When interpreting BB_0651 expression changes in response to environmental stressors, researchers should follow these analytical guidelines:

For example, in studies of B. burgdorferi's response to doxycycline, researchers observed that neighboring gene BB_0650 showed significant downregulation (-1.20 log2FC) at 3 hours followed by upregulation (1.58 log2FC) at 24 hours, demonstrating the importance of temporal analysis in stress response studies .

How might BB_0651 contribute to developing new diagnostic approaches for Lyme disease?

BB_0651 could potentially contribute to new diagnostic approaches for Lyme disease through several research avenues:

• Serological marker development:

  • Evaluate BB_0651 as a potential antigen for detecting Borrelia-specific antibodies in patient sera

  • Determine if antibodies against BB_0651 appear during specific phases of infection

  • Assess if immune responses to BB_0651 can differentiate between active and past infections

• Molecular diagnostic enhancement:

  • Develop BB_0651-targeted PCR assays for direct detection of Borrelia DNA in clinical samples

  • Design multiplex assays incorporating BB_0651 and other targets to improve sensitivity and specificity

  • Evaluate BB_0651 sequence variations for species-level identification of Borrelia

• Antigen detection approaches:

  • Investigate the presence of BB_0651 in bodily fluids during active infection

  • Develop highly sensitive immunoassays for detecting BB_0651 protein or fragments

• Host response profiling:

  • Characterize host immune signatures specifically induced by BB_0651

  • Develop diagnostic algorithms incorporating BB_0651-specific host responses

• Point-of-care test development:

  • Evaluate BB_0651's utility in rapid diagnostic platforms like lateral flow assays

  • Determine optimal sample types and preparation methods for BB_0651 detection

The specificity of BB_0651 to Borrelia burgdorferi makes it a candidate for diagnostic development, particularly if expressed during human infection and sufficiently immunogenic to generate detectable antibody responses .

What methodologies would be appropriate for investigating BB_0651's potential role in antibiotic resistance?

To investigate BB_0651's potential role in antibiotic resistance, researchers should employ these methodologies:

• Expression analysis under antibiotic pressure:

  • Perform RNA-Seq of B. burgdorferi exposed to various antibiotics at sub-inhibitory concentrations

  • Compare expression patterns at different time points (e.g., 3 hours vs. 24 hours) to distinguish immediate from adaptive responses

  • Conduct quantitative RT-PCR validation of expression changes

• Genetic manipulation studies:

  • Generate BB_0651 knockout mutants and assess changes in antibiotic susceptibility

  • Create overexpression strains to determine if increased BB_0651 levels confer resistance

  • Perform site-directed mutagenesis to identify critical residues for potential resistance functions

• Structural and functional characterization:

  • Investigate potential interactions between BB_0651 and antibiotics through binding assays

  • Determine if BB_0651 can modify or transport antibiotics using in vitro assays

  • Examine membrane integrity and permeability in relation to BB_0651 expression levels

• Systems biology approaches:

  • Analyze transcriptomic and proteomic networks to identify BB_0651's position in stress response pathways

  • Examine co-expression patterns with known resistance determinants

• In vivo persistence studies:

  • Test if BB_0651 mutants show altered persistence during antibiotic treatment in animal models

  • Evaluate if BB_0651 expression changes during the development of antibiotic-tolerant forms

These approaches would be particularly relevant given the observation that neighboring genes like BB_0650 show significant expression changes in response to doxycycline treatment, suggesting coordinated regulation within this genomic region during antibiotic stress .