Recombinant Borrelia burgdorferi YbbR-like domain-containing protein BB_0009 (BB_0009)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BB_0009; YbbR-like domain-containing protein BB_0009
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Target Names
BB_0009
Target Protein Sequence
MEIGKKIINIIKLLFDDWQNKAISILIAILMFVAFNFNKIESITTEKEFKIILNDQIALG KIPDFSKIKITIKVNKDDLKYLDLNKIILFIEASSIKIPGSYKLPIKIKNLNSIHIAEYK LSKTNVLLNLDNKVSKLVKIEPKFKLIEKDGKGEYFIAKYNILPENLLVYGPEQELKKIN TIQTNVKEFDTRTLFVSDYLEVVPPNPLVMFEKSHVVVNIYLNKKYSNTTIKSPNLIFNN LKNGLEIKDKEKIINSENKMFVKIKTRLSEKQIKAHINNQNISLAFDLADIKTPGIYNIA ANIILKENINETEIYDYEPKKIKLEIIESSEIKP
Uniprot No.

Target Background

Database Links

KEGG: bbu:BB_0009

STRING: 224326.BB_0009

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Borrelia burgdorferi YbbR-like domain-containing protein BB_0009?

    YbbR-like domain-containing protein BB_0009 is a protein encoded by the Borrelia burgdorferi genome (gene name: BB_0009). YbbR domains are widespread throughout Eubacteria and can be expressed as monomeric units, linked in tandem repeats, or cotranslated with other domains . While the precise role of BB_0009 remains undefined, the location of multiple YbbR domain-encoding genes in the Bacillus subtilis glmM operon suggests a role in cell growth, division, and virulence . BB_0009 from Borrelia burgdorferi is a full-length protein consisting of 334 amino acid residues .

  • What expression systems are commonly used for recombinant BB_0009 production?

    Recombinant BB_0009 is typically expressed in Escherichia coli expression systems, which allow for efficient production of the protein with an N-terminal His-tag for purification purposes . This approach follows standard protocols for bacterial protein expression, where the gene encoding BB_0009 is cloned into an appropriate expression vector and transformed into E. coli host cells. The cells are then cultured, and protein expression is induced, followed by cell lysis and protein purification using affinity chromatography techniques targeting the His-tag .

  • What is the structural characterization of YbbR domains?

    Structural studies of YbbR domains from Desulfitobacterium hafniense Y51 (a related model) show that these domains adopt a unique fold dominated by β-strands . The topology follows a "figure 8" pattern with some strands coiling around the domain perimeter and others crossing the center . Despite low amino acid identity between different YbbR domains (e.g., 23% between domains I and IV), they maintain nearly identical topologies . This structural conservation suggests functional importance. A similar topology is found in the C-terminal domain of stress-responsive bacterial ribosomal proteins TL5 and L25 .

Experimental Methodology

  • What are the optimal storage conditions for recombinant BB_0009?

    Based on published protocols for recombinant BB_0009, the following storage conditions are recommended:

    Storage PhaseRecommended ConditionsNotes
    Short-term storage4°C for up to one weekFor working aliquots in active use
    Long-term storage-20°C/-80°CStore as aliquots to avoid repeated freeze-thaw cycles
    Shipping formLyophilized powderIncreases stability during transportation
    Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Maintains protein stability
    ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mLRecommended to add 5-50% glycerol (final concentration) for long-term storage

    It is critical to avoid repeated freeze-thaw cycles as they can degrade the protein structure and activity. Upon receipt of lyophilized protein, it should be briefly centrifuged to bring contents to the bottom of the vial before opening .

  • How can I assess the purity and functionality of recombinant BB_0009?

    Assessment of recombinant BB_0009 should follow these methodological steps:

    1. Purity assessment:

      • SDS-PAGE analysis under reducing conditions with Coomassie blue staining (expect >90% purity)

      • Western blot using anti-His antibodies to confirm the presence of the His-tagged protein

      • Mass spectrometry to verify the molecular weight and confirm protein identity

    2. Structural integrity:

      • Circular dichroism (CD) spectroscopy to assess secondary structure elements

      • Limited proteolysis to probe domain organization and stability

      • Dynamic light scattering to evaluate homogeneity and aggregation state

    3. Functional assays:

      • Binding studies with potential interaction partners identified from literature

      • Investigation of potential role in phosphopantetheinyl transferase activities, given YbbR domains have been identified as substrates for surfactin-type phosphopantetheinyl transferases

    These techniques provide complementary information about the quality and functionality of the recombinant protein preparation.

  • What experimental design considerations are important when studying BB_0009 in the context of the Borrelia life cycle?

    When designing experiments to study BB_0009 in the context of Borrelia's life cycle, consider these methodological approaches:

    1. Expression profiling across life stages:

      • qRT-PCR to quantify BB_0009 transcript levels during different stages of the enzootic cycle

      • Western blotting to determine protein expression levels in tick versus mammalian host environments

      • RNA-seq analysis comparing gene expression profiles between wild-type and BB_0009 mutant strains

    2. Animal and tick model considerations:

      • Use established mouse models that mimic aspects of human Lyme disease

      • Include both needle inoculation and tick-mediated transmission experiments, as differences in bacterial gene expression requirements have been observed between these modes

      • Consider the impact of tick salivary proteins on BB_0009 function during transmission

    3. Environmental variable control:

      • Culture media selection is critical - BSK-II and BSK-H media can drive differences in B. burgdorferi biology at the molecular level and affect infection ability

      • Temperature shifts should mimic natural conditions (37°C for mammalian host, 23-25°C for unfed ticks)

      • pH variations should be considered as they affect gene expression in Borrelia

    4. Statistical design:

      • Use appropriate sample sizes based on power analysis

      • Include biological replicates (different bacterial cultures) and technical replicates

      • Apply appropriate statistical tests for data analysis based on distribution and experimental design

    These considerations ensure that experimental results accurately reflect the biological role of BB_0009 throughout the Borrelia life cycle.

  • How can contradictory results in BB_0009 functional studies be reconciled?

    Reconciling contradictory results in BB_0009 research requires a systematic approach:

    1. Experimental conditions audit:

      • Compare culture media compositions, as different formulations (like BSK-II versus BSK-H) can affect B. burgdorferi biology at the molecular level

      • Verify protein expression systems used (E. coli strains, expression vectors, induction conditions)

      • Assess differences in purification protocols that might affect protein folding or activity

    2. Cross-laboratory validation:

      • Implement standardized protocols across research groups

      • Exchange materials (strains, plasmids, antibodies) to eliminate reagent variability

      • Conduct blind testing of samples in multiple laboratories

    3. Statistical analysis review:

      • Perform meta-analysis of available data sets

      • Re-analyze raw data using consistent statistical methods

      • Evaluate whether appropriate statistical tests were applied based on data distribution

    4. Biological context consideration:

      • Examine whether contradictions arise from studying different phases of the bacterial life cycle

      • Consider host-specific effects that might influence protein function

      • Evaluate potential post-translational modifications that could alter protein activity

    5. New experimental approaches:

      • Design experiments that directly address contradictions

      • Consider using new technologies that offer higher resolution or sensitivity

      • Develop conditional expression systems to study BB_0009 function in specific contexts

    This methodical approach can help identify sources of variability and resolve apparent contradictions in the literature.

Future Research Directions

  • What are the emerging techniques that could advance our understanding of BB_0009 function?

    Several cutting-edge methodologies show promise for elucidating BB_0009 function:

    1. Cryo-electron microscopy (cryo-EM):

      • Can determine high-resolution structures of BB_0009 in complex with interaction partners

      • Allows visualization of conformational changes under different conditions

      • Requires less protein than crystallography and can capture multiple conformational states

    2. Proximity labeling techniques:

      • BioID or APEX2 fusions to BB_0009 can identify proximal proteins in living cells

      • Helps map the protein interaction network of BB_0009 in its native environment

      • Can reveal transient interactions missed by traditional co-immunoprecipitation

    3. Single-cell techniques:

      • Single-cell RNA-seq to analyze heterogeneity in BB_0009 expression within bacterial populations

      • Live-cell imaging with fluorescently tagged BB_0009 to track localization during infection

    4. CRISPR interference (CRISPRi) systems:

      • Allow tunable repression of BB_0009 expression rather than complete knockout

      • Can study dosage effects and partial loss of function

      • Applicable in difficult-to-transform organisms like Borrelia

    5. Structural proteomics approaches:

      • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map protein dynamics and interaction surfaces

      • Cross-linking mass spectrometry (XL-MS) to identify spatial relationships between domains and interaction partners

    These advanced methods can provide new insights into BB_0009 function that were previously inaccessible with conventional techniques.

  • How might BB_0009 be involved in Borrelia burgdorferi's immune evasion strategies?

    The potential role of BB_0009 in immune evasion could be investigated through these methodological approaches:

    1. Immunological assays:

      • Compare immune responses to wild-type and BB_0009-deficient B. burgdorferi in vitro and in vivo

      • Assess changes in cytokine profiles, phagocytosis rates, and complement activation

      • Measure antibody generation against various B. burgdorferi antigens in the presence and absence of BB_0009

    2. Structural analysis of immune interactions:

      • Study whether BB_0009 directly interacts with host immune components using binding assays

      • Investigate if BB_0009 structurally mimics host proteins to divert immune responses

      • Examine if BB_0009 undergoes antigenic variation to evade antibody recognition

    3. Gene expression modulation:

      • Determine if BB_0009 regulates expression of known virulence factors or immune evasion genes

      • Analyze transcriptome changes in immune cells exposed to recombinant BB_0009

      • Investigate whether BB_0009 affects the bacterium's ability to enter dormant states that resist immune clearance

    Understanding BB_0009's potential role in immune evasion could provide new targets for therapeutic intervention in persistent Borrelia infections.

  • What computational approaches can help predict BB_0009 function?

    Computational methods for predicting BB_0009 function include:

    1. Homology modeling and molecular dynamics simulations:

      • Build three-dimensional models based on the known structures of YbbR domains

      • Simulate protein dynamics to identify flexible regions and potential binding sites

      • Model interactions with predicted binding partners

    2. Machine learning approaches:

      • Train algorithms on known protein-protein interactions to predict BB_0009 binding partners

      • Use feature extraction from sequence and structure to predict functional sites

      • Apply deep learning methods to identify patterns in BB_0009 sequence that correlate with function

    3. Evolutionary analysis:

      • Perform phylogenetic analysis across Borrelia species to identify conserved regions under selective pressure

      • Use co-evolution analysis to predict functionally coupled residues and potential interaction interfaces

      • Apply ancestral sequence reconstruction to understand the evolutionary trajectory of BB_0009

    4. Network analysis:

      • Integrate BB_0009 into protein-protein interaction networks predicted for B. burgdorferi

      • Identify functional modules and pathways that include BB_0009

      • Map BB_0009 to broader systems biology models of bacterial persistence and pathogenesis

    These computational approaches can generate testable hypotheses about BB_0009 function that guide experimental design and interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.