Recombinant Bos gaurus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Bos gaurus (Seladang) (Indian bison)
Target Names
Target Protein Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This enzyme complex, along with succinate dehydrogenase (complex II, CII) and ubiquinol-cytochrome c oxidoreductase (complex III, CIII), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC utilizes four electrons from cytochrome c and four protons from the matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of MT-CO2 in cellular respiration?

Cytochrome c oxidase subunit 2 (MT-CO2) is a highly conserved protein directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX) during cellular respiration. This electron transfer is crucial to ATP production . The protein consists of 227 amino acids and contains transmembrane domains that anchor it within the mitochondrial membrane .

Functionally, MT-CO2 plays an integral role in the proton-pumping process coupled with the reduction of dioxygen to water. The protein contains specific residues, such as Asp-51, that undergo redox-coupled structural changes essential for this proton pumping mechanism .

How does recombinant MT-CO2 differ from the native protein?

Recombinant MT-CO2 from Bos gaurus maintains the essential amino acid sequence of the native protein but typically includes modifications to facilitate laboratory use:

FeatureNative MT-CO2Recombinant MT-CO2
SourceMitochondriaE. coli expression system
TagsNoneN-terminal His-tag or other purification tags
GlycosylationPresent (if any)Typically absent in E. coli-expressed protein
SolubilityMembrane-boundMay be engineered for increased solubility
FormIntegrated in complexOften isolated single subunit

When working with recombinant MT-CO2, researchers should be aware that the protein is typically provided as a lyophilized powder that requires reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommended addition of 5-50% glycerol for long-term storage .

Why is Bos gaurus (gaur) MT-CO2 of particular interest to researchers?

Bos gaurus, the largest extant wild bovine species native to South and Southeast Asia, provides a valuable comparative model for understanding the evolution of mitochondrial proteins in bovine species. Recent genomic analysis of gaur has identified significant changes in gene copy number in three biological pathways, including proton transmembrane transporter activity and oxygen transport, compared to other mammals .

These adaptations likely reflect evolutionary responses to environmental challenges related to climate and nutrition, making gaur MT-CO2 particularly valuable for comparative studies with domesticated cattle (Bos indicus and Bos taurus). Understanding these differences can provide insights into both the adaptation of wild species and the effects of domestication on mitochondrial function.

How does the proton pumping mechanism of MT-CO2 relate to evolutionary adaptations in Bos gaurus?

The proton pumping mechanism of cytochrome c oxidase is a sophisticated process in which specific residues undergo redox-coupled structural changes. Research has demonstrated that in bovine cytochrome c oxidase, an aspartate residue (Asp-51) located near the enzyme surface is critical for this function .

Improved X-ray structures (at 1.8/1.9-Å resolution in oxidized/reduced states) reveal that oxidation of the low-spin heme creates a net positive charge that drives proton transport from the mitochondrial interior to Asp-51 via a water channel and hydrogen-bond network. The enzyme's reduction then induces proton ejection from the aspartate to the exterior .

In Bos gaurus, this mechanism may have evolved specific adaptations related to the species' environmental niche. The gaur genome shows significant changes in gene copy number in pathways related to proton transmembrane transporter activity compared to other mammals, suggesting adaptation to specific challenges related to climate and nutrition . Researchers investigating these adaptations should focus on:

  • Comparative structural analysis of the water channel and hydrogen-bond network

  • Identification of gaur-specific substitutions in the proton transfer pathway

  • Functional characterization of these variations using recombinant proteins

What challenges exist in expressing functional recombinant MT-CO2, and how can they be overcome?

Expressing functional recombinant MT-CO2 presents several challenges due to its membrane-associated nature and complex interactions with other respiratory chain components. Current methodologies typically involve E. coli expression systems for producing the isolated subunit , but researchers should consider:

ChallengeMethodological Solution
Membrane protein expressionUse specialized E. coli strains designed for membrane protein expression; consider fusion partners that enhance solubility
Proper foldingExpress at lower temperatures (16-20°C); use chaperone co-expression systems
Functional assessmentReconstitute with other subunits; develop activity assays specific to MT-CO2 function
Post-translational modificationsConsider eukaryotic expression systems for studies requiring native-like modifications
Storage stabilityAdd 5-50% glycerol to storage buffer; avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

Researchers have successfully expressed recombinant Bos javanicus MT-CO2 (a closely related species) as a full-length protein (1-227 amino acids) with N-terminal His-tag in E. coli, suggesting similar approaches would be viable for Bos gaurus MT-CO2 .

How can researchers investigate the evolutionary selection pressures on MT-CO2 in wild bovine populations?

Investigating evolutionary selection pressures on MT-CO2 requires sophisticated analytical approaches to distinguish between neutral variation, purifying selection, and positive selection. Based on studies in other organisms, researchers should consider:

  • Comparative sequence analysis across multiple Bos gaurus populations to identify nucleotide and amino acid variation

  • Calculation of nonsynonymous to synonymous substitution ratios (omega) using maximum likelihood models of codon substitution

  • Application of branch-site maximum likelihood models to identify sites experiencing positive selection within specific lineages

  • Functional characterization of identified variants to assess their impact on protein function

Previous research on other species has demonstrated that while the majority of codons in COII are under strong purifying selection (omega << 1), approximately 4% of sites may evolve under relaxed selective constraint (omega = 1) . Similar patterns might be expected in Bos gaurus, potentially with specific sites experiencing positive selection that reflect adaptation to the species' ecological niche.

What protocols are most effective for purifying recombinant Bos gaurus MT-CO2?

Effective purification of recombinant Bos gaurus MT-CO2 requires protocols optimized for membrane-associated proteins. Based on established methods for similar proteins, the following procedure is recommended:

  • Expression optimization:

    • Transform expression vector containing His-tagged MT-CO2 into E. coli

    • Culture in appropriate media (e.g., LB or TB) until mid-log phase

    • Induce with IPTG at reduced temperature (16-20°C) for 16-20 hours

  • Cell lysis and solubilization:

    • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

    • Resuspend in lysis buffer containing appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

    • Lyse cells by sonication or pressure-based methods

    • Clear lysate by high-speed centrifugation (20,000 × g, 30 min, 4°C)

  • Affinity purification:

    • Apply cleared lysate to Ni-NTA or similar affinity resin

    • Wash extensively with buffer containing low imidazole concentrations

    • Elute with buffer containing high imidazole concentrations

  • Further purification:

    • Perform size exclusion chromatography to remove aggregates and increase purity

    • Concentrate using appropriate molecular weight cutoff filters

  • Storage:

    • Add glycerol to 5-50% final concentration

    • Aliquot to avoid freeze-thaw cycles

    • Store at -20°C/-80°C for long-term storage

The final product should be assessed by SDS-PAGE to confirm purity greater than 90% .

How can researchers assess the functional integrity of purified recombinant MT-CO2?

Assessing the functional integrity of purified recombinant MT-CO2 requires methodologies that evaluate both structural integrity and functional activity:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Thermal shift assays to assess protein stability

    • Dynamic light scattering to detect aggregation

  • Functional assessment:

    • Electron transfer activity: spectrophotometric assays monitoring cytochrome c oxidation

    • Reconstitution experiments with other cytochrome c oxidase subunits

    • Binding assays with cytochrome c using isothermal titration calorimetry or surface plasmon resonance

  • Proton pumping assessment:

    • Reconstitution into liposomes with pH-sensitive fluorescent dyes

    • Measurement of proton translocation using pH electrodes

Research has shown that specific residues like Asp-51 are critical for proton pumping without affecting oxygen reduction activity . Therefore, site-directed mutagenesis of corresponding residues in recombinant Bos gaurus MT-CO2 followed by functional assessment can provide valuable insights into structure-function relationships.

What techniques are most appropriate for comparing MT-CO2 sequence variation across bovine species?

Comparing MT-CO2 sequence variation across bovine species requires a combination of molecular techniques and computational analyses:

  • Sequence acquisition:

    • PCR amplification using universal primers for mammalian COII

    • Direct sequencing of amplicons

    • Next-generation sequencing of mitochondrial genomes

    • Mining existing genome databases

  • Sequence alignment and analysis:

    • Multiple sequence alignment using MUSCLE, MAFFT, or similar algorithms

    • Identification of variable sites using sequence visualization tools

    • Calculation of sequence divergence metrics

  • Evolutionary analysis:

    • Phylogenetic tree reconstruction using maximum likelihood methods

    • Calculation of dN/dS ratios to detect selection

    • Branch-site tests to identify lineage-specific selection

  • Structural mapping:

    • Mapping variable sites onto protein structural models

    • Assessing the functional implications of observed substitutions

Previous studies in marine copepods have shown that despite COII's integral role in electron transport, extensive intraspecific nucleotide and amino acid variation can exist, with interpopulation divergence reaching nearly 20% at the nucleotide level . While bovine species may show lower levels of variation, similar analytical approaches can reveal important evolutionary patterns.

How does sequence conservation of MT-CO2 in Bos gaurus compare with other bovine species?

The MT-CO2 gene encodes a highly conserved protein essential for cellular respiration, but comparative analysis reveals interesting patterns of conservation and divergence across bovine species:

Species ComparisonExpected Conservation Pattern
Within Bos gaurus populationsHigh conservation within populations with possible geographic variation
Bos gaurus vs. Bos javanicusHigh similarity reflecting recent evolutionary divergence
Wild bovine vs. domesticated cattleConservation of catalytic sites with possible divergence in regulatory regions

While specific data on Bos gaurus MT-CO2 sequence conservation is limited in the provided search results, studies in other organisms suggest that most codons in COII are under strong purifying selection (omega << 1), while approximately 4% of sites may evolve under relaxed selective constraint (omega = 1) .

Researchers investigating MT-CO2 evolution should note that while intrapopulation divergence in some species is virtually nonexistent, interpopulation divergence can be substantial, including nonsynonymous substitutions that may affect protein function .

What insights can MT-CO2 provide about mitonuclear coevolution in bovine species?

MT-CO2 provides a valuable system for studying mitonuclear coevolution due to its extensive interactions with nuclear-encoded proteins in the respiratory chain:

  • Coevolutionary constraints:
    MT-CO2 directly interacts with nuclear-encoded subunits of cytochrome c oxidase and with cytochrome c itself, creating selection pressure for compensatory mutations to maintain these interactions .

  • Hybrid incompatibility mechanisms:
    Disruption of coevolved mitonuclear interactions can lead to reduced fitness in hybrids between divergent populations, potentially contributing to speciation barriers.

  • Adaptive evolution signatures:
    Some codons in MT-CO2 may be under positive selection to compensate for amino acid substitutions in nuclear-encoded interaction partners .

  • Domestication effects:
    Comparison between wild Bos gaurus and domesticated cattle can reveal how artificial selection has affected mitonuclear coevolution.

The gaur genome analysis revealed significant changes in gene copy number in pathways including proton transmembrane transporter activity and oxygen transport compared to other mammals . These changes may reflect coordinated evolution between mitochondrial and nuclear genomes in response to environmental challenges.

How has MT-CO2 evolved in relation to environmental adaptation in wild bovine species?

The evolution of MT-CO2 in wild bovine species likely reflects adaptation to specific environmental challenges:

  • Thermal adaptation:
    Species living in different temperature regimes may show adaptations in MT-CO2 that optimize function across their thermal range.

  • Altitude adaptation:
    Bovine species at different elevations may exhibit adaptations related to oxygen binding and utilization efficiency.

  • Metabolic adaptation:
    Variations in diet and activity patterns may drive selection on MT-CO2 to optimize energy production.

  • Climate adaptation:
    The gaur genome shows significant changes in gene copy number in pathways related to proton transmembrane transporter activity, which may reflect adaptation to climate challenges .

Research approaches to investigate these adaptations should include:

  • Comparative analysis of MT-CO2 sequences from species occupying different ecological niches

  • Correlation of sequence variants with environmental parameters

  • Functional characterization of variants to assess their impact on protein performance under different conditions

How can MT-CO2 analysis contribute to Bos gaurus conservation efforts?

As Bos gaurus is listed as vulnerable by the International Union for Conservation of Nature (IUCN) , MT-CO2 analysis can contribute significantly to conservation efforts:

  • Population genetic structure assessment:

    • MT-CO2 sequences can help identify distinct maternal lineages

    • Patterns of genetic diversity can inform conservation unit designation

  • Genetic health monitoring:

    • Levels of MT-CO2 variation can serve as indicators of population genetic health

    • Reduced variation may signal genetic bottlenecks requiring management intervention

  • Hybridization detection:

    • MT-CO2 sequences can help identify hybridization with domestic cattle

    • Pure Bos gaurus lineages can be distinguished for conservation prioritization

  • Evolutionary potential assessment:

    • Functional variation in MT-CO2 may indicate adaptive potential

    • Conservation strategies can be developed to preserve adaptive diversity

The recent completion of the gaur reference genome provides an essential foundation for these conservation efforts, as "the gaur genome will also provide the foundation to conserve the species" .

What research applications exist for recombinant Bos gaurus MT-CO2 in understanding mitochondrial diseases?

Recombinant Bos gaurus MT-CO2 offers several valuable research applications for understanding mitochondrial diseases:

  • Structure-function relationship studies:

    • Site-directed mutagenesis to recreate disease-associated mutations

    • Functional characterization of mutant proteins to understand pathogenic mechanisms

  • Therapeutic development platforms:

    • Screening compounds that restore function to mutant MT-CO2

    • Identifying molecules that enhance wild-type MT-CO2 activity

  • Evolutionary medicine insights:

    • Comparing disease-associated mutations with natural variation in Bos gaurus

    • Understanding compensatory mechanisms that may exist in wild populations

  • Bioenergetic adaptation models:

    • Using Bos gaurus MT-CO2 as a model for studying adaptations to metabolic stress

    • Investigating how wild species optimize mitochondrial function under challenging conditions

Research on bovine cytochrome c oxidase has already provided important insights into the proton pumping mechanism, showing that specific residues like Asp-51 are critical for this function . Similar studies using recombinant Bos gaurus MT-CO2 could further illuminate the molecular basis of mitochondrial diseases affecting this pathway.

How might comparative studies of MT-CO2 inform our understanding of domestication in bovine species?

Comparative studies of MT-CO2 between wild Bos gaurus and domesticated cattle can provide insights into the effects of domestication on mitochondrial function:

  • Selection signatures:

    • Identification of selection pressures unique to domestic lineages

    • Detection of relaxed selection in traits no longer essential under human management

  • Metabolic adaptation:

    • Comparison of energy efficiency between wild and domestic bovines

    • Understanding how domestication has altered metabolic pathways

  • Mitonuclear coordination:

    • Investigation of coordinated changes between mitochondrial and nuclear genomes

    • Assessment of how artificial selection may have affected mitonuclear communication

  • Hybrid performance:

    • Evaluation of mitonuclear compatibility in crosses between wild and domestic bovines

    • Understanding the genetic basis of hybrid vigor or breakdown

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.