Recombinant Bos indicus ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

MT-ATP6 encodes subunit a of ATP synthase, a membrane-embedded protein essential for proton translocation across the mitochondrial inner membrane. Key roles include:

  • Proton Channel Formation: Works with the c-ring to facilitate proton flow, driving ATP synthesis .

  • Complex V Assembly: Stabilizes ATP synthase dimers and oligomers, critical for cristae formation .

  • Energy Conversion: Couples proton gradient energy to ATP production via rotational catalysis .

Conserved residues in subunit a (e.g., arginine at position 159 in humans) are vital for proton transport . Mutations here disrupt ATP synthesis, leading to neurodegenerative and metabolic disorders .

Pathogenic Mutations and Yeast Model Insights

Yeast (Saccharomyces cerevisiae) models have elucidated the impact of MT-ATP6 mutations on ATP synthase function. Notable findings include:

Key Mutations and Functional Deficits

Mutation (Human)Yeast EquivalentFunctional Impact
m.8950G>A (p.V142I)aV159ISevere ATP synthesis impairment; reduced oxidative phosphorylation .
m.9025G>A (p.G167S)aG184SDisrupted proton channel stability; ~50% ATP production loss .
m.8909T>C (p.L128S)aL145S20–30% reduction in ATP synthesis rate; compromised enzyme assembly .

Biomedical Applications

Recombinant MT-ATP6 proteins enable:

  • Drug Screening: Testing compounds targeting ATP synthase dysfunction in mitochondrial diseases .

  • Structural Studies: Cryo-EM and X-ray crystallography to map mutation-induced conformational changes .

  • Diagnostic Tools: Developing assays for detecting pathogenic MT-ATP6 variants in patient samples .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Bos indicus (Zebu)
Target Names
Target Protein Sequence
MNENLFASFITPVILGLPLVTLIVLFPSLLFPTSNRLVSNRFVTLQQWMLQLVSKQMMSI HNSKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNK TKASLAHFLPQGTPTPLIPMLVIIETISLFIQPVALAVRLTANITAGHLLIHLIGGATLA LMSISTTTALITFTILILLTILEFAVAMIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Database Links

KEGG: biu:2885970

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ATP synthase subunit a (MT-ATP6) in mitochondrial energy production?

ATP synthase subunit a (MT-ATP6) is essential for moving protons across the mitochondrial inner membrane, a process coupled to ATP synthesis. This subunit forms part of the membrane-embedded F₀ domain of ATP synthase (Complex V). The proton translocation through subunit a drives the rotation of the c-ring, which is mechanically coupled to the F₁ catalytic domain where ADP is phosphorylated to produce ATP . In the complete ATP synthase complex, subunit a works in conjunction with the c-ring to convert the energy of the proton gradient (proton motive force) into mechanical rotation, ultimately producing ATP from ADP and inorganic phosphate . The protein is critical for establishing the proton pathway that enables the chemiosmotic coupling essential for oxidative phosphorylation.

How conserved is the MT-ATP6 sequence across different species and what does this suggest about its functional importance?

The MT-ATP6 gene shows strong evolutionary conservation across species, reflecting its critical role in the fundamental process of ATP synthesis. Comparative studies reveal high sequence homology in key functional regions, particularly at residues involved in proton translocation. For example, when investigating pathogenic mutations, researchers have effectively used yeast models because the homologous residues in yeast and human ATP6 proteins serve similar structural and functional roles .

The search results specifically highlight the conservation of certain amino acid residues that, when mutated, cause significant dysfunction. For instance, the leucine residue targeted by the pathogenic mutation m.9191T>C (L222P in humans) is highly conserved across species, indicating its crucial role in the proper functioning of ATP synthase . This conservation pattern suggests that these residues are essential for either the structural integrity of the subunit a or its proton-conducting function.

What is the structural organization of MT-ATP6 within the complete ATP synthase complex?

MT-ATP6 (subunit a) forms a critical component of the membrane-embedded F₀ sector of ATP synthase. Recent high-resolution structural studies reveal that subunit a contains multiple transmembrane α-helices that interact with the c-ring rotor to form the proton translocation pathway.

Specifically, research indicates that subunit a contains a four α-helix bundle that is crucial for its function . This structural arrangement creates the pathway through which protons can move across the inner mitochondrial membrane. The interaction between subunit a and the c-ring creates two half-channels: one allowing protons to access the c-ring from the intermembrane space and another permitting proton release to the matrix .

In the complete ATP synthase complex, subunit a is held in position relative to the c-ring primarily through hydrophobic interactions rather than being rigidly fixed by the peripheral stalk, as evidenced by studies on the bacterial ATP synthase from Bacillus PS3 . This arrangement allows for the necessary rotary motion while maintaining the proton pathway integrity.

Why is yeast considered an effective model organism for studying human MT-ATP6 variants and their pathogenicity?

Yeast (Saccharomyces cerevisiae) serves as an excellent model for studying human MT-ATP6 mutations for several key reasons:

  • Absence of heteroplasmy: Unlike human cells where wild-type and mutant mitochondrial DNA often coexist (heteroplasmy), yeast mitochondrial DNA segregates rapidly to homoplasmy, allowing the study of mutations in a controlled genetic background .

  • Amenability to mitochondrial genome manipulation: Yeast allows for direct genetic transformation of mitochondria, enabling researchers to introduce specific mutations into the ATP6 gene and study their effects in isolation .

  • Survival capacity: Yeast can survive loss-of-function mtDNA mutations due to its good fermenting capacity, making it possible to study mutations that would be lethal in obligate aerobic organisms .

  • Evolutionary conservation: The strong conservation of ATP synthase structure and function between yeast and humans means that findings in yeast are often translatable to human disorders .

Research has validated this approach by demonstrating that mutations causing severe clinical phenotypes in humans also dramatically affect yeast ATP synthase function, while mutations associated with milder human diseases compromise oxidative phosphorylation in yeast less severely .

What are the methodological approaches for introducing MT-ATP6 variants into experimental models?

For introducing MT-ATP6 variants into experimental models like yeast, researchers employ several sophisticated genetic engineering approaches:

  • Mitochondrial transformation in yeast: Researchers use a technique involving crossing strains containing variant ATP6 genes with receptor strains. For example, in one study, researchers created ρ⁻ petite strains containing mutant ATP6 variants and then crossed them with strain MR10 where the ATP6 gene was replaced by ARG8ᵐ (a mitochondrial version of a nuclear gene involved in arginine biosynthesis). This crossing allows the integration of the variant ATP6 gene into a complete mitochondrial genome through recombination .

  • Homoplasmy achievement: Following mitochondrial recombination, the modified mitochondrial genome segregates to homoplasmy within approximately a dozen mitotic divisions, even without selection pressure, yielding strains with uniform mitochondrial genomes expressing only the variant ATP6 .

  • Verification of integration: The successful introduction of variants is typically verified using PCR-based methods and confirmed by functional assays including measuring growth on non-fermentable carbon sources and analyzing ATP synthase assembly by techniques such as Blue Native PAGE .

This methodological approach allows for the systematic evaluation of MT-ATP6 variants in a controlled genetic background, enabling researchers to directly attribute functional consequences to specific mutations.

Besides yeast, what other model systems are valuable for investigating MT-ATP6 function and pathogenic variants?

While yeast is a predominant model for MT-ATP6 research, several other model systems offer complementary advantages:

  • Bacterial systems: Bacterial ATP synthases, such as those from Bacillus PS3 and Escherichia coli, provide simplified models that retain the core functionality of ATP synthase. These systems are particularly valuable for structural studies due to their relative simplicity and ease of genetic manipulation. For instance, the Bacillus PS3 ATP synthase expressed in E. coli has been successfully used for cryo-EM imaging to build atomic models of the complex in different rotational states .

  • Mammalian cell lines: Cancer cell lines such as HeLa cells have been used to study the interactions between ATP synthase components and regulatory proteins like the inhibitor protein IF1. These studies have revealed alternative binding sites and interactions that may be relevant to understanding ATP synthase regulation in both normal and pathological conditions .

  • Recombinant protein approaches: Isolated domains of the ATP synthase complex can be expressed as recombinant proteins for in vitro studies. For example, the N-terminal domain of human OSCP (oligomycin sensitivity conferring protein) has been produced recombinantly for NMR experiments to study interactions with potential inhibitory peptides .

Each model system offers distinct advantages depending on the research question being addressed, ranging from structural analyses to functional studies of specific protein-protein interactions.

What are the optimal methods for expression and purification of recombinant MT-ATP6 protein?

The expression and purification of recombinant MT-ATP6 (subunit a) present significant challenges due to its hydrophobic nature and inclusion in a large multiprotein complex. Based on current research methodologies, the following approach is recommended:

  • Expression system selection: Bacterial expression systems, particularly E. coli, have been successfully used for expressing complete ATP synthase complexes from thermophilic bacteria like Bacillus PS3, which offer greater stability . For bovine (Bos indicus) MT-ATP6, a similar approach could be adapted, though membrane protein expression typically requires careful optimization of growth conditions and inducer concentrations.

  • Purification strategy: Effective purification of ATP synthase typically involves:

    • Membrane fraction isolation through differential centrifugation

    • Solubilization using mild detergents (digitonin has been shown to preserve ATP synthase dimers and supercomplexes)

    • Affinity chromatography (typically using His-tagged subunits)

    • Size exclusion chromatography for obtaining pure, monodisperse samples

  • Quality assessment: Purified complexes containing MT-ATP6 should be evaluated using:

    • Blue Native PAGE to assess complex integrity and assembly state

    • Western blotting with subunit-specific antibodies to confirm the presence of MT-ATP6

    • Functional assays to verify ATP synthesis/hydrolysis capabilities

When studying specific MT-ATP6 variants, researchers have successfully used yeast genetic systems to express the variants within the native complex rather than attempting to work with the isolated subunit , as the isolated hydrophobic subunit a is challenging to maintain in a properly folded state.

What structural analysis techniques are most effective for studying MT-ATP6 conformation and interactions?

Several advanced structural biology techniques have proven effective for analyzing MT-ATP6 structure and interactions:

  • Cryo-electron microscopy (cryo-EM): This has emerged as the method of choice for determining the structure of complete ATP synthase complexes. Recent studies have used cryo-EM to visualize ATP synthase in multiple rotational states, revealing critical details about subunit a's conformation and its interactions with other components . This technique allows visualization of the membrane-embedded regions without the need for crystallization.

  • Nuclear Magnetic Resonance (NMR): While challenging for the entire complex due to its size, NMR has been employed to study specific interactions, such as those between peptides and ATP synthase components. For example, NMR has been used to characterize the interaction between peptides and the N-terminal domain of the OSCP subunit of ATP synthase .

  • Cross-linking coupled with mass spectrometry: This approach can identify specific residues involved in interactions between subunit a and other components of the ATP synthase complex, providing data on the spatial relationships between different subunits.

  • Molecular dynamics simulations: Based on high-resolution structural data, computational approaches can provide insights into the dynamic behavior of subunit a, particularly regarding conformational changes during proton translocation.

The combination of these techniques provides complementary data, allowing researchers to build comprehensive models of MT-ATP6 structure and function within the ATP synthase complex.

How can researchers effectively analyze the assembly and stability of ATP synthase complexes containing MT-ATP6 variants?

The analysis of ATP synthase complex assembly and stability when incorporating MT-ATP6 variants requires several complementary approaches:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique is crucial for assessing the assembly state of ATP synthase complexes. Mitochondrial digitonin extracts are separated on native gels and then analyzed using antibodies specific to ATP synthase subunits (including subunit a and β-F₁). This approach reveals the distribution of ATP synthase between dimeric, monomeric, and free F₁ forms, providing insights into how MT-ATP6 variants affect complex assembly .

Assembly StateWild-typePathogenic VariantMild Variant
Dimers + Monomers++++++ to +++++ to ++++
Free F₁++++ to +++++ to ++
  • SDS-PAGE and Western blotting: This technique quantifies the steady-state levels of individual ATP synthase subunits, including MT-ATP6 (subunit a). Researchers typically normalize these levels to a reference protein like porin (outer mitochondrial membrane protein). This approach helps determine if MT-ATP6 variants affect the stability of the protein itself or other complex components .

  • Pulse-chase experiments: These can provide information on the turnover rates of ATP synthase subunits, helping to distinguish between assembly defects and increased degradation of properly assembled complexes.

  • Respiratory growth assessments: Growth on non-fermentable carbon sources (like glycerol or lactate) provides a functional readout of ATP synthase assembly and activity. Quantitative growth measurements (doubling time, final optical density) correlate with the severity of assembly defects .

The most informative approach combines these methodologies to obtain a comprehensive picture of how specific MT-ATP6 variants affect ATP synthase assembly, stability, and function.

What are the most reliable assays for measuring ATP synthase activity in preparations containing recombinant MT-ATP6?

The functional characterization of ATP synthase containing recombinant MT-ATP6 requires multiple complementary assays to provide a comprehensive assessment of enzymatic function:

  • ATP synthesis rate measurement: This is the most direct assessment of ATP synthase function. Isolated mitochondria are energized with respiratory substrates (e.g., NADH, succinate) to generate a proton gradient, and the rate of ATP production is measured, typically using a luciferase-based luminescence assay. As demonstrated in studies with yeast models, this approach can quantify the impact of specific MT-ATP6 variants on oxidative phosphorylation efficiency .

  • ATP hydrolysis assay: This measures the reverse function of ATP synthase and can be performed with isolated mitochondria or purified enzyme. The rate of inorganic phosphate release from ATP is measured spectrophotometrically. The ratio of ATP synthesis to hydrolysis rates provides insights into the effect of MT-ATP6 variants on the directionality of the enzyme .

  • Proton pumping assay: Using fluorescent pH-sensitive dyes or pH electrodes, researchers can measure the ability of ATP synthase to pump protons when supplied with ATP. This approach specifically assesses the function of the proton channel, which directly involves MT-ATP6 .

  • Membrane potential measurements: Fluorescent dyes sensitive to membrane potential (e.g., TMRM, JC-1) can indirectly assess ATP synthase function by measuring how efficiently the enzyme uses or generates the proton motive force.

Data from studies of MT-ATP6 variants show that pathogenic mutations can reduce ATP synthesis rates by 70-90% compared to wild-type, while milder variants show more moderate reductions (30-50%) .

How can researchers distinguish between assembly defects and functional impairments when studying MT-ATP6 variants?

Distinguishing between assembly defects and functional impairments of assembled complexes requires a systematic analytical approach:

MT-ATP6 VariantATP Synthase AssemblyATP Synthesis ActivityPrimary Defect Type
aL242PSeverely reduced~10% of wild-typeAssembly disruption of α-helix bundle
Suppressor variants (aL242S, aL242T)Near normal85-88% of wild-typeRestoration of structural integrity
Other mild variantsSlightly reduced70-80% of wild-typePrimarily functional

This multifaceted approach allows researchers to determine the mechanistic basis of dysfunction caused by specific MT-ATP6 variants.

What experimental approaches are effective for studying the proton translocation mechanism involving MT-ATP6?

Studying the proton translocation mechanism involving MT-ATP6 (subunit a) requires specialized techniques that can probe this fundamental yet challenging aspect of ATP synthase function:

  • Site-directed mutagenesis of key residues: Systematic mutation of conserved residues in the predicted proton pathway, followed by functional assessment, can identify critical amino acids involved in proton translocation. The search results indicate that mutations affecting proton conduction can be distinguished from those affecting structure by their specific impact on ATP synthesis without dramatically altering complex assembly .

  • Hydrogen/deuterium exchange mass spectrometry: This technique can identify regions of MT-ATP6 that are accessible to the aqueous environment and potentially involved in forming the proton half-channels.

  • pH-dependent kinetic studies: By measuring ATP synthase activity across a range of pH values and analyzing the resulting pH-activity profiles, researchers can gain insights into the protonation states of key residues involved in proton translocation.

  • Molecular dynamics simulations: Computational approaches using structural data can model proton movement through the proposed half-channels in subunit a and its interaction with the c-ring.

  • Spectroscopic techniques: Specialized spectroscopic methods, such as FTIR difference spectroscopy, can track protonation changes in specific amino acid residues during ATP synthase operation.

Recent structural studies of bacterial ATP synthases have provided a foundation for understanding the proton path through ATP synthase, revealing that subunit a creates two offset half-channels that allow protons to access the c-ring from the intermembrane space and exit to the matrix . This arrangement couples proton movement across the membrane to rotation of the c-ring, which drives ATP synthesis.

What criteria are used to establish the pathogenicity of novel MT-ATP6 variants identified in patients?

Establishing the pathogenicity of novel MT-ATP6 variants requires a multi-faceted approach combining clinical, biochemical, and functional evidence:

  • Conservation analysis: High evolutionary conservation of the affected amino acid across species suggests functional importance. Studies evaluate whether the residue is conserved from humans to simpler organisms like yeast .

  • Functional studies in model systems: Expression of the variant in yeast and measurement of ATP synthesis rates provides direct evidence of functional impact. Based on the search results, pathogenic mutations typically reduce ATP synthesis by >70% compared to wild-type, while variants of uncertain significance show milder effects . The results from eight novel MT-ATP6 variants illustrate this approach:

MT-ATP6 VariantConservationATP Synthesis ImpactPathogenicity Assessment
m.8950G>A (p.V142I)ConservedSignificant reductionLikely pathogenic
m.9025G>A (p.G167S)Highly conservedSignificant reductionLikely pathogenic
m.9029A>G (p.H168R)ConservedSignificant reductionLikely pathogenic
m.8843T>C (p.I106T)Moderately conservedMinor impactLikely benign
m.9016A>G (p.I164V)Moderately conservedMinor impactLikely benign
m.9058A>G (p.T178A)Less conservedMinor impactLikely benign
m.9139G>A (p.A205T)Less conservedMinor impactLikely benign
m.9160T>C (p.Y212H)Moderately conservedMinor impactLikely benign
  • Biochemical assessment of ATP synthase assembly: BN-PAGE analysis of ATP synthase complex formation helps distinguish between variants affecting assembly and those affecting function of properly assembled complexes .

  • Clinical correlation: Correlation between the severity of biochemical defects in experimental models and the severity of clinical phenotypes in patients carrying the variant strengthens pathogenicity claims .

  • Heteroplasmy analysis: In patients, the percentage of mitochondrial DNA carrying the variant (heteroplasmy level) and its correlation with disease severity provides additional evidence for pathogenicity.

This systematic approach allows researchers to categorize variants as likely pathogenic, likely benign, or of uncertain significance, guiding clinical management and genetic counseling.

How do pathogenic mutations in MT-ATP6 disrupt the proton translocation mechanism at the molecular level?

Pathogenic mutations in MT-ATP6 (subunit a) can disrupt proton translocation through several molecular mechanisms, as revealed by detailed structural and functional studies:

  • Disruption of the α-helical bundle structure: The search results indicate that one major mechanism, exemplified by the m.9191T>C (aL222P) mutation, involves disruption of the four α-helix bundle that forms the core of subunit a . Introduction of proline, a known helix-breaker, in place of a conserved leucine residue destabilizes this critical structure. This structural disruption was confirmed by the finding that substituting the leucine with either serine or threonine (which are more compatible with α-helical structure than proline) restored near-normal function .

  • Alteration of the proton half-channels: Some mutations affect residues that line the proton half-channels, directly impacting proton access to or release from the c-ring. These mutations may alter the hydrophilicity, charge, or size of the channel, affecting proton conductance.

  • Disruption of the a/c-ring interface: Mutations at the interface between subunit a and the c-ring can alter the crucial interaction that couples proton movement to ring rotation. The hydrophobic interactions between these components are essential for maintaining the integrity of the proton path while allowing rotation .

  • Alteration of critical salt bridges or hydrogen bonds: Some pathogenic mutations disrupt electrostatic interactions that stabilize the conformation of subunit a or its interaction with other subunits, indirectly affecting proton translocation.

The search results specifically highlight how suppressor mutations can restore function by compensating for these structural disruptions, providing valuable insights into the molecular mechanisms of pathogenicity .

What are the current therapeutic approaches targeting ATP synthase dysfunction caused by MT-ATP6 mutations?

Current therapeutic approaches for ATP synthase dysfunction caused by MT-ATP6 mutations focus on several strategies, though many remain experimental:

Research continues to develop and refine these approaches, with the goal of providing effective treatments for patients with mitochondrial diseases caused by MT-ATP6 mutations.

How does the interaction between MT-ATP6 and other ATP synthase subunits influence enzyme efficiency and regulation?

The interaction between MT-ATP6 (subunit a) and other ATP synthase components creates a finely tuned molecular machine whose efficiency and regulation depend on precise subunit relationships:

  • Interaction with the c-ring: The interface between subunit a and the c-ring forms the crucial proton translocation pathway. Recent structural studies of bacterial ATP synthases have revealed that subunit a creates two half-channels that allow protons to access and exit the c-ring, coupling proton movement to ring rotation . This interaction must be precisely maintained to ensure proton translocation efficiency while allowing rotational movement.

  • Role of the peripheral stalk: The peripheral stalk, which contains subunits b, d, F6, and OSCP, holds the stationary components (including subunit a) in place relative to the rotating components. In simpler bacterial systems like Bacillus PS3, the peripheral stalk shows significant conformational variability between rotational states, suggesting it provides flexible anchoring rather than rigid fixation . This flexibility may be important for maintaining optimal subunit a positioning during catalysis.

  • Regulatory interactions: Emerging research suggests that subunit a may participate in regulatory interactions beyond its core catalytic role. The search results indicate that inhibitory proteins like IF1 can bind to the OSCP subunit under specific conditions, potentially affecting the entire complex's function including proton translocation through subunit a .

  • Assembly coordination: The proper incorporation of MT-ATP6 is critical for ATP synthase assembly. Studies of pathogenic mutations show that disruption of subunit a structure can severely compromise complex assembly, highlighting its role in the coordinated assembly process .

Understanding these complex interactions is crucial for developing strategies to address ATP synthase dysfunction caused by MT-ATP6 mutations or for designing modulators of ATP synthase activity.

What are the emerging technologies that may advance our understanding of ATP synthase and MT-ATP6 function?

Several cutting-edge technologies are poised to revolutionize our understanding of ATP synthase and MT-ATP6 function:

  • Cryo-electron tomography (cryo-ET): This technique allows visualization of ATP synthase in its native membrane environment at near-atomic resolution, providing insights into how MT-ATP6 functions within intact mitochondria rather than in isolated complexes.

  • Single-molecule techniques: Methods like single-molecule FRET (Förster Resonance Energy Transfer) can track conformational changes in real-time during ATP synthase operation, potentially revealing dynamic aspects of MT-ATP6 function that are not captured in static structural studies.

  • Time-resolved cryo-EM: This emerging approach could potentially capture ATP synthase in multiple intermediate states during the catalytic cycle, providing a more complete picture of how MT-ATP6 participates in proton translocation.

  • Advanced computational approaches: Molecular dynamics simulations using supercomputers can model proton movement through the half-channels in subunit a at an unprecedented level of detail, complementing experimental approaches.

  • Expanded genetic engineering tools: The development of mitochondria-targeted CRISPR systems and base editors may soon allow more precise genetic manipulation of MT-ATP6 in mammalian cells, enabling more sophisticated functional studies.

  • Organoid and tissue-specific models: These could provide insights into how MT-ATP6 variants affect ATP synthase function in different tissues, helping explain the tissue-specific manifestations of mitochondrial diseases.

These technological advances will likely provide a more comprehensive understanding of MT-ATP6 structure, function, and its role in ATP synthase operation, potentially leading to novel therapeutic approaches for mitochondrial disorders.

How might comparative studies across different Bos species inform our understanding of MT-ATP6 function and evolution?

Comparative studies across different Bos species (including Bos indicus, Bos taurus, and other closely related bovids) offer valuable insights into MT-ATP6 function and evolution:

  • Adaptation to metabolic demands: Different Bos species have evolved under varying environmental conditions (e.g., tropical vs. temperate climates), potentially leading to adaptations in ATP synthase efficiency. Comparative studies could reveal how MT-ATP6 sequence variations contribute to these adaptations, particularly in relation to thermotolerance and metabolic efficiency.

  • Conservation vs. variation analysis: By examining which regions of MT-ATP6 are strictly conserved across all Bos species versus those showing variation, researchers can identify:

    • Critical functional domains that cannot tolerate change

    • Regions that may be involved in species-specific optimization

    • Potential sites of adaptive evolution

  • Structure-function relationships: Correlating species-specific amino acid variations with differences in ATP synthase kinetics, thermal stability, or regulatory properties could reveal subtle aspects of MT-ATP6 function not evident from studies of a single species.

  • Hybrid complex studies: Creating chimeric ATP synthase complexes with MT-ATP6 from different Bos species combined with other subunits from a standard model organism could help isolate the specific functional contributions of MT-ATP6 sequence variations.

  • Evolutionary rate analysis: Comparing the evolutionary rate of MT-ATP6 with that of other mitochondrial genes across Bos species could reveal selective pressures unique to ATP synthase and provide context for understanding pathogenic mutations in humans.

These comparative approaches could generate insights not only into the basic biology of ATP synthase but also potentially inform the development of more efficient expression systems for recombinant MT-ATP6 production and the design of optimized ATP synthase variants for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.