Recombinant Bos indicus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Bos indicus (Zebu)
Target Names
Target Protein Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a critical component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation, a vital process for cellular energy production. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase activity. Cytochrome c oxidase uniquely catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, comprised of heme A3 and copper B (CuB), reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Database Links

KEGG: biu:2885980

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Bos indicus MT-CO2 and how does it differ from other mammalian species?

MT-CO2 is one of the three mitochondrial DNA-encoded subunits (along with MT-CO1 and MT-CO3) that form the catalytic core of respiratory complex IV. In mammals, the MT-CO2 gene typically spans approximately 683 base pairs and produces a protein of about 227 amino acids with a molecular mass of approximately 26 kDa .

The protein contains two distinct domains: an N-terminal domain with two transmembrane alpha-helices anchored in the inner mitochondrial membrane, and a C-terminal domain containing the critical binuclear copper A center (CuA) . This CuA center is located within a conserved cysteine loop at positions 196 and 200, with a conserved histidine at position 204 .

What role does MT-CO2 play in the electron transport chain and oxidative phosphorylation?

MT-CO2 serves a crucial function in the electron transport chain as it contains the primary electron acceptor site for cytochrome c. The CuA center in MT-CO2 receives electrons from reduced cytochrome c and transfers them to the heme a center in MT-CO1, which ultimately transfers them to the binuclear center (heme a3-CuB) where molecular oxygen is reduced to water .

This electron transfer process is coupled to proton pumping across the inner mitochondrial membrane, contributing to the establishment of a proton gradient that drives ATP synthesis via ATP synthase. MT-CO2 is therefore essential for efficient cellular respiration and energy production .

The functional significance of MT-CO2 is underscored by its high degree of evolutionary conservation and the fact that mutations in this subunit can lead to severe metabolic disorders characterized by energy production deficiencies .

What expression systems are most effective for producing recombinant Bos indicus MT-CO2?

Based on experimental evidence with similar proteins, E. coli expression systems have been successfully employed for recombinant MT-CO2 production. For instance, the pET-32a vector and E. coli Transetta (DE3) expression system have been used effectively for the expression of insect COXII proteins . This system typically employs IPTG induction for controlled expression.

For Bos indicus MT-CO2 specifically, researchers should consider:

  • Codon optimization for E. coli expression to enhance translation efficiency

  • Inclusion of affinity tags (such as His6-tag) to facilitate purification

  • Expression at lower temperatures (16-20°C) to improve protein folding

  • Use of specialized E. coli strains that provide rare tRNAs that may be required for efficient translation of Bos indicus codons

Alternative expression systems such as yeast (Pichia pastoris) or insect cells (baculovirus expression system) might provide better results for maintaining proper folding and post-translational modifications, especially if the recombinant protein requires specific chaperones for proper folding that are not present in E. coli.

What are the optimal conditions for solubilizing and purifying recombinant Bos indicus MT-CO2?

MT-CO2 is a membrane protein containing transmembrane domains, making its solubilization and purification challenging. A methodological approach would include:

  • Membrane fraction isolation: After cell lysis, separate the membrane fraction by ultracentrifugation.

  • Solubilization: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or amphipol to extract the protein from membranes without denaturing it. Based on recent studies with bovine CcO, newly synthesized detergents have shown promise in maintaining protein activity .

  • Affinity purification: If the recombinant protein contains a His-tag, use Ni²⁺-NTA affinity chromatography for initial purification. This approach has been successful with similar proteins, yielding concentrations of approximately 50 μg/mL .

  • Further purification: Size exclusion chromatography or ion exchange chromatography may be employed for higher purity.

  • Buffer optimization: A typical buffer system might include 20 mM Tris-HCl (pH 8.0), 0.1 M NaCl, 10% glycerol, and 2 mM DTT to maintain protein stability .

Monitor purification efficiency using SDS-PAGE and Western blotting with antibodies specific to MT-CO2 or the affinity tag. For functional studies, it's critical to maintain the native conformation of the protein by avoiding harsh conditions during purification.

How can researchers effectively assess the functional activity of recombinant Bos indicus MT-CO2?

Functional assessment of recombinant MT-CO2 should focus on its ability to participate in electron transfer. Several methodological approaches include:

  • Cytochrome c oxidation assay: Monitor the oxidation of reduced cytochrome c spectrophotometrically at 550 nm. The rate of decrease in absorbance correlates with MT-CO2 activity . This assay can be performed under various conditions to assess factors affecting enzyme function.

  • Oxygen consumption measurements: Using an oxygen electrode or optical sensors to measure oxygen consumption rates in the presence of reduced cytochrome c and the recombinant protein.

  • Reconstitution experiments: Incorporate the purified recombinant MT-CO2 into liposomes or nanodiscs to create a more native-like membrane environment for functional studies.

  • Spectroscopic analysis: UV-visible, infrared, and EPR spectroscopy can provide insights into the redox state of the copper centers and structural integrity of the recombinant protein .

A typical experimental setup for cytochrome c oxidation assay would include:

  • 50 mM phosphate buffer (pH 7.4)

  • 50 μM reduced cytochrome c

  • Variable concentrations of recombinant MT-CO2

  • Temperature control at 25°C or 37°C

  • Continuous monitoring of absorbance at 550 nm for 3-5 minutes

Calculate enzyme activity as the rate of cytochrome c oxidation per unit time per amount of enzyme.

What approaches can be used to study the interaction between recombinant MT-CO2 and other components of the cytochrome c oxidase complex?

Understanding protein-protein interactions involving MT-CO2 is crucial for elucidating its role within the complete COX complex. Several approaches include:

  • Co-immunoprecipitation (Co-IP): Using antibodies against MT-CO2 to pull down interacting partners from cell lysates expressing the other components of the COX complex.

  • Surface Plasmon Resonance (SPR): Immobilize recombinant MT-CO2 on a sensor chip and measure binding kinetics with other purified COX subunits or cytochrome c.

  • Isothermal Titration Calorimetry (ITC): Measure the thermodynamic parameters of binding between MT-CO2 and other proteins.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify interaction interfaces.

  • Molecular docking and simulation: Computational approaches to predict interaction sites based on the structural information of MT-CO2 and other COX subunits.

For studying the specific interaction between MT-CO2 and cytochrome c, researchers should consider the evolutionary patterns observed in different species. Studies in primates have shown that changes in charge-bearing residues involved in binding cytochrome c have affected the electrostatic interaction between COX and cytochrome c . This evolutionary perspective could provide valuable insights for designing experiments to study these interactions in Bos indicus.

What are the most effective techniques for determining the structure of recombinant Bos indicus MT-CO2?

Structural characterization of recombinant MT-CO2 requires selecting appropriate techniques based on the research questions:

For any structural study, protein stability and homogeneity are crucial. Consider using amphipol or newly synthesized detergents that have been successfully used with bovine CcO to stabilize the protein in a native-like conformation . Additionally, adding metal ions (particularly copper) might be necessary to maintain the structural integrity of the CuA center.

How do post-translational modifications affect the structure and function of Bos indicus MT-CO2?

Post-translational modifications (PTMs) can significantly impact the structure, stability, and function of MT-CO2. Although specific information about PTMs in Bos indicus MT-CO2 is limited, research approaches should consider:

  • Identification of PTMs: Use mass spectrometry-based approaches (LC-MS/MS) to identify and map PTMs on the recombinant protein.

  • Site-directed mutagenesis: Create variants where potential modification sites are mutated to assess functional consequences.

  • Comparative analysis: Compare PTM patterns between recombinant protein and native protein isolated from Bos indicus tissue.

Potential PTMs that might be relevant include:

  • Phosphorylation, which may regulate enzyme activity or protein-protein interactions

  • Oxidative modifications, which might affect the redox properties of the protein

  • Methylation or acetylation, which could influence protein stability or assembly into the COX complex

When expressing recombinant MT-CO2 in bacterial systems like E. coli, be aware that many eukaryotic PTMs will not occur, potentially affecting protein function. For studies requiring native-like PTMs, consider eukaryotic expression systems or enzymatic modification of the purified protein in vitro.

How does Bos indicus MT-CO2 differ from Bos taurus MT-CO2, and what are the functional implications of these differences?

Comparing MT-CO2 sequences from Bos indicus and Bos taurus can reveal evolutionary adaptations that may reflect different metabolic requirements or environmental adaptations:

  • Sequence analysis: Perform multiple sequence alignment to identify amino acid variations between the two subspecies. Focus particularly on residues in or near the CuA center, transmembrane regions, and cytochrome c binding sites.

  • Structural modeling: Use homology modeling to predict how identified sequence variations might affect protein structure.

  • Functional assays: Compare the enzymatic activities, thermal stabilities, and pH optima of recombinant MT-CO2 from both subspecies.

Potential functional implications of differences might include:

  • Altered efficiency of electron transfer under different temperature conditions

  • Different affinities for cytochrome c

  • Varied responses to cellular stress conditions

  • Modified assembly dynamics into the complete COX complex

These comparative studies could provide insights into how MT-CO2 has adapted to the specific environmental conditions and metabolic requirements of zebu cattle, which are known for their heat tolerance and adaptation to tropical environments.

What can studies of recombinant Bos indicus MT-CO2 reveal about mitochondrial evolution and adaptation?

Studies of Bos indicus MT-CO2 can contribute to our understanding of mitochondrial evolution and adaptation through several research approaches:

  • Phylogenetic analysis: Compare MT-CO2 sequences across various bovine species and subspecies to reconstruct evolutionary relationships and identify selection signatures.

  • Biochemical adaptation studies: Investigate how MT-CO2 variants perform under conditions mimicking different environmental stresses (heat, hypoxia, oxidative stress).

  • Coevolution analysis: Examine the coevolutionary patterns between mitochondrial-encoded MT-CO2 and nuclear-encoded subunits of the COX complex .

  • Functional genomics approaches: Correlate genomic variations with functional differences using recombinant protein studies.

Research on various species living in extreme environments has shown that mitochondrial-encoded COX subunits can undergo adaptive evolution. For example, specific mutations in COX I and COX II have been identified in high-altitude mammals like pikas, with functional significance related to oxygen binding or protein stability . Similar adaptations might be present in Bos indicus, potentially contributing to their superior adaptation to hot, tropical environments compared to Bos taurus.

How can recombinant Bos indicus MT-CO2 be incorporated into artificial membrane systems for bioenergetic studies?

Incorporating recombinant MT-CO2 into artificial membrane systems provides a controlled environment for studying its function. Methodological approaches include:

  • Liposome reconstitution:

    • Prepare liposomes using phospholipids (typically a mixture of phosphatidylcholine, phosphatidylethanolamine, and cardiolipin to mimic the inner mitochondrial membrane)

    • Incorporate purified MT-CO2 along with other necessary components using detergent-mediated reconstitution

    • Remove detergent using bio-beads or dialysis

    • Verify incorporation using freeze-fracture electron microscopy or functional assays

  • Nanodiscs system:

    • Assemble nanodiscs using membrane scaffold proteins and appropriate phospholipids

    • Incorporate MT-CO2 during the assembly process

    • Purify the resulting MT-CO2-containing nanodiscs using size exclusion chromatography

  • Planar lipid bilayers:

    • Form planar lipid bilayers across an aperture

    • Incorporate MT-CO2 by fusion of proteoliposomes or direct addition in detergent

These systems can be used for:

  • Measuring electron transfer rates under controlled conditions

  • Investigating how lipid composition affects MT-CO2 function

  • Studying the interaction of MT-CO2 with other components of the respiratory chain

  • Examining how environmental factors affect protein function in a membrane context

The choice of artificial membrane system should be guided by the specific research questions and the technical capabilities available.

What role might recombinant Bos indicus MT-CO2 play in understanding mitochondrial disorders in cattle and related species?

Recombinant Bos indicus MT-CO2 can serve as a valuable tool for understanding mitochondrial disorders through several research approaches:

  • Disease-associated mutation modeling:

    • Introduce mutations corresponding to those identified in mitochondrial disorders into recombinant MT-CO2

    • Assess the functional consequences using activity assays, stability measurements, and structural studies

    • Compare results with clinical phenotypes to establish structure-function relationships

  • Interspecies complementation studies:

    • Test whether Bos indicus MT-CO2 can functionally complement deficiencies in COX activity in cells from other species with known MT-CO2 mutations

    • Investigate whether unique features of Bos indicus MT-CO2 confer any protective effects against certain stressors

  • Development of screening assays:

    • Establish high-throughput assays using recombinant MT-CO2 to screen for compounds that might restore function to mutant forms

    • Develop diagnostic tools to detect abnormalities in COX function in cattle

  • Gene therapy model development:

    • Use knowledge gained from recombinant protein studies to inform the development of potential gene therapy approaches for mitochondrial disorders affecting COX function

Understanding the structure-function relationships in Bos indicus MT-CO2 could provide insights into species-specific vulnerabilities or resistances to mitochondrial dysfunction, potentially leading to improved diagnostic and therapeutic approaches for both veterinary and comparative medicine applications.

What are the major challenges in expressing and purifying functional recombinant Bos indicus MT-CO2, and how can they be overcome?

Researchers face several significant challenges when working with recombinant MT-CO2:

ChallengeSolution Approaches
Membrane protein solubility- Use specialized detergents (DDM, digitonin, amphipol)
- Express as fusion with solubility enhancers (MBP, SUMO)
- Optimize extraction conditions (pH, ionic strength)
Maintaining copper center integrity- Add copper salts during purification
- Include reducing agents to prevent oxidation
- Avoid chelating agents in buffers
Proper folding- Express at lower temperatures (16-20°C)
- Co-express with molecular chaperones
- Use eukaryotic expression systems for complex proteins
Protein aggregation- Include glycerol (10-20%) in buffers
- Optimize protein concentration
- Use size exclusion chromatography to remove aggregates
Low expression yields- Optimize codon usage for expression host
- Test different promoter systems
- Use fed-batch fermentation for higher cell density
Protein degradation- Include protease inhibitors during purification
- Remove problematic protease cleavage sites through silent mutations
- Purify at 4°C to minimize proteolytic activity

A systematic approach to optimization, testing multiple conditions in parallel, can help identify the optimal expression and purification conditions. Additionally, developing activity assays that can be performed on crude extracts may help quickly assess the functionality of the expressed protein under different conditions.

How can structural and functional studies of recombinant MT-CO2 inform the design of more efficient oxygen-reducing biocatalysts?

Understanding the structure-function relationships of MT-CO2 can inspire the development of biomimetic catalysts through several research pathways:

  • Identification of critical residues:

    • Use site-directed mutagenesis to identify amino acids essential for electron transfer and oxygen reduction

    • Map the electron transfer pathway within the protein

    • Determine how protein environment modulates the redox properties of the CuA center

  • Design principles for synthetic catalysts:

    • Analyze the coordination chemistry of the CuA center

    • Investigate how the protein structure positions substrates for optimal reaction

    • Understand how the protein controls proton delivery during oxygen reduction

  • Development of hybrid systems:

    • Create fusion proteins combining the most efficient domains of MT-CO2 with other functional proteins

    • Immobilize recombinant MT-CO2 on electrode surfaces for bioelectrochemical applications

    • Develop minimalist peptide catalysts that mimic the essential functions of MT-CO2

  • Molecular dynamics simulation studies:

    • Model oxygen and water movement within the protein

    • Identify design features that prevent formation of reactive oxygen species

    • Simulate electron transfer kinetics under different conditions

The CuA center in MT-CO2, with its unique binuclear structure and high efficiency in electron transfer, represents a particularly valuable model for developing catalysts for oxygen reduction reactions, with potential applications in fuel cells, biosensors, and other technologies requiring controlled electron transfer to oxygen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.