Recombinant Bos indicus Growth hormone receptor (GHR)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

Recombinant Bos indicus GHR is a transmembrane protein produced through E. coli expression systems. Key structural features include:

PropertySpecification
Molecular Weight28 kDa (non-glycosylated polypeptide chain with 237 amino acids)
Amino Acid SequenceStarts with Ala-Phe-Ser-Gly-Ser; shares 99.7% homology with Bos taurus GHR
SolubilityReconstituted in sterile H₂O (≥100 µg/ml)
Purity>95% (verified via SDS-PAGE and RP-HPLC)
Storage StabilityLyophilized form stable at <-18°C; short-term storage at 4°C post-reconstitution

The receptor lacks exon 3 (GHRd3 variant) in some alleles, a feature linked to growth efficiency in Bos indicus breeds .

Genetic Characteristics and Polymorphisms

Bos indicus GHR exhibits unique genetic traits compared to Bos taurus:

  • Promoter Region: A short liver-specific promoter lacking the LINE-1 retrotransposon, prevalent in 60% of Japanese Black cattle .

  • Coding Sequence: Two silent nucleotide substitutions (C144T and T354C) without altering the protein sequence .

  • Polymorphisms: Tyrosine-rich cytoplasmic domains with ruminant-specific variations (e.g., Y539) that influence insulin-like growth factor 1 (IGF-1) signaling .

Notable polymorphisms associated with dairy traits include:

VariantImpactStudy
F279Y (GHR)Increases milk fat and protein percentages
S18N (PRLR)Affects protein and fat yield

Functional Role and Mechanisms

GHR activation triggers dimerization and downstream signaling via the JAK-STAT pathway, regulating:

  • Growth: Mediates IGF-1 synthesis in the liver, critical for postnatal development .

  • Reproduction: Modulates follicular growth rates and ovulation in cattle with low body condition scores (BCS ≤2.5) .

  • Metabolism: Enhances lipolysis under negative energy balance, indirectly affecting reproductive efficiency .

In Bos indicus, GHR expression in the pituitary remains unchanged under recombinant bovine somatotropin (rbST) treatment, suggesting breed-specific transcriptional regulation .

GH mRNA Expression in Bos indicus

A study comparing Nelore (Bos indicus) and Simmental × Nelore crosses revealed:

ParameterNeloreCrossbredSignificance
Pituitary Weight1.95 ± 0.10 g2.58 ± 0.03 gP<0.05
GH mRNA Levels31.9% higherBaselineP>0.075
Response to rbSTNo changeNo changeNot significant

Agricultural Implications

  • The short GHR promoter allele is proposed as a marker for improving meat yields in Japanese Black cattle .

  • Polymorphisms like F279Y are prioritized in selective breeding programs to enhance dairy productivity .

Applications

Recombinant Bos indicus GHR is utilized for:

  • Biomarker Development: Screening genetic variants associated with growth efficiency .

  • Drug Discovery: Testing GH analogs and receptor antagonists .

  • Agricultural Biotechnology: Optimizing rbST protocols for cattle with suboptimal BCS .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order remarks. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GHR; Growth hormone receptor; GH receptor; Somatotropin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-634
Protein Length
Full Length of Mature Protein
Species
Bos indicus (Zebu)
Target Names
GHR
Target Protein Sequence
FSGSEATPAFLVRASQSLQILYPVLETNSSGNPKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLMVTSVPMYSLRLDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQFPWFLIIMFGILGLAVTLFLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSNDHEKSLNIFGAKDDDSGRTSCYEPDILEADFHVSDMCDGTSEVAQPQRLKGEADISCLDQKNQNNSPSNDAAPANQQPSVIHVEENKPRPLLIGGTESTHQAVHHQLSNPSSLANIDFYAQVSDITPAGNVVLSPGQKNKTGNPQCDTHPEVVTSCQANFIVDNAYFCEVDAKKYIALAPHVEAESHVEPSFNQEDIYITTESLTTTAGRSGTAEHVPSSEIPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP
Uniprot No.

Target Background

Function
The Growth hormone receptor (GHR) is a receptor for pituitary gland growth hormone. It plays a crucial role in regulating postnatal body growth. Upon ligand binding, GHR couples to and activates the JAK2/STAT5 pathway. The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may modulate or inhibit GH signaling.
Database Links

UniGene: Bt.111379

Protein Families
Type I cytokine receptor family, Type 1 subfamily
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Growth hormone-binding protein]: Secreted.

Q&A

What are the key structural and functional differences between Bos indicus and Bos taurus growth hormone receptors?

Bos indicus (Zebu) cattle show distinct genetic variations in their growth hormone receptor compared to Bos taurus breeds. Research indicates that these differences manifest primarily in the extracellular domain of the GHR protein, affecting ligand binding affinity and downstream signaling intensity. The genetic polymorphisms in GHR are distributed differently between these species, with Bos indicus showing specific allele frequencies (A: 0.87, G: 0.13) that differ from Bos taurus populations . These structural differences contribute to the distinctive growth patterns, heat tolerance, and metabolic efficiency observed in Bos indicus breeds. The research approach to understanding these differences typically involves comparative genetic sequencing, protein structure modeling, and functional assays measuring receptor activation under controlled conditions.

How does recombinant bovine somatotropin (rbST) treatment affect GH mRNA expression in Bos indicus pituitaries?

Treatment with recombinant bovine somatotropin (rbST) significantly influences the expression patterns of growth hormone mRNA in the pituitary glands of Bos indicus cattle. Studies show that rbST administration creates a feedback loop that modulates endogenous GH production at the transcriptional level . This relationship is particularly important in research contexts because it demonstrates the plasticity of the GH-IGF axis in response to exogenous hormone treatment. When designing experiments to study this effect, researchers should consider:

  • The timing of tissue collection post-treatment is critical (typically 7-14 days for maximum response)

  • Age and developmental stage of animals significantly affect response magnitude

  • Breed-specific variations within Bos indicus populations may yield different expression profiles

  • Quantitative PCR with appropriate reference genes is the method of choice for accurate measurement

For research purposes, establishing a proper baseline measurement before rbST administration is essential for meaningful comparative analysis.

What heterozygosity levels are typically observed in GHR alleles among Bos indicus populations?

Heterozygosity data for GHR in Bos indicus populations reveal important genetic diversity patterns that impact research study design. Analysis shows observed heterozygosity (Ho) of 0.21 and expected heterozygosity (He) of 0.22 for the GHR locus in sampled Bos indicus populations . The polymorphism information content (PIC) value of 0.20 indicates moderate genetic diversity at this locus. These metrics are crucial when:

  • Designing association studies for growth traits

  • Selecting representative animals for experimental groups

  • Interpreting genotype-phenotype relationships

  • Developing breeding strategies for research herds

When conducting GHR research in Bos indicus, researchers should screen their study populations to determine the specific heterozygosity profile, as geographical isolation and selective breeding can significantly alter these values from the published averages.

What is the optimal protocol for GHR genotyping in Bos indicus research studies?

The optimal protocol for GHR genotyping in Bos indicus research involves a multi-step process that must be carefully optimized for research reliability. Based on published methodologies, researchers should:

  • Extract high-quality genomic DNA from blood or tissue samples (preferably using silica-membrane-based methods for higher purity)

  • Amplify the target GHR regions using PCR with primers designed specifically for Bos indicus sequences (PCR conditions: 35 cycles with annealing temperatures between 51-59°C depending on primer design)

  • Perform restriction fragment length polymorphism (RFLP) analysis using AluI enzyme for GHR gene variants

  • Visualize results using 2% agarose gel electrophoresis with appropriate molecular weight markers

  • Validate results with sequencing for a subset of samples to confirm genotype assignments

This approach provides reliable genotype data with approximately 95% call rates when properly optimized. For high-throughput requirements, researchers may consider transitioning to SNP array platforms, though custom design may be necessary to capture Bos indicus-specific variants.

How should researchers design association studies to investigate GHR polymorphisms and growth traits in Bos indicus cattle?

Designing robust association studies for GHR polymorphisms requires meticulous planning to ensure valid, reproducible results. The recommended experimental design includes:

  • Sample size determination based on expected effect sizes (minimum 300-400 animals for detecting moderate associations)

  • Stratified sampling across different age groups, with balanced representation of genotypes

  • Comprehensive phenotyping protocol including:

    • Birth weight (BW)

    • Weaning weight at 205 days (WW 205)

    • Yearling weight at 365 days (YW 365)

    • Average daily gain in different growth phases (ADG 1, ADG 2)

Statistical analysis should employ general linear models that account for fixed effects (sex, season, management system) and random effects (sire, dam) . Data should be analyzed using a mixed model approach that can accommodate the hierarchical structure of the data. The following table illustrates the expected range of measurements by genotype based on existing research:

LocusGenotype (n)BWWW 205YW 365ADG 1ADG 2
GHRAA (54)26.62 ± 5.85108.93 ± 27.93251.90 ± 104.600.40 ± 0.140.69 ± 0.29
GHRAG (19)24.09 ± 5.49110.07 ± 21.99223.50 ± 74.40.42 ± 0.100.61 ± 0.20

When interpreting results, researchers should be cautious about potential gene-by-environment interactions that may confound associations in different production systems.

What considerations are important when designing expression studies for GHR in heat-stressed Bos indicus cattle?

Heat stress response is a critical area of Bos indicus GHR research that requires specific experimental considerations. When designing expression studies under heat stress conditions, researchers should:

  • Implement climate-controlled chambers with precise temperature and humidity regulation

  • Establish appropriate acclimation periods (minimum 7-10 days) before treatment

  • Monitor physiological parameters including:

    • Respiration rate and rectal temperature at standardized times

    • Cortisol levels as stress indicators (baseline values in unstressed Bos indicus: 3.92 ± 1.20 ng/mL)

    • Heat shock protein expression as molecular markers of stress

  • Consider social rank effects on stress response, as low-ranking and high-ranking animals show differential cortisol responses (0.5 ± 0.1 ng/mL vs. 6.4 ± 1.2 ng/mL respectively after habituation)

  • Collect tissue samples at consistent circadian timepoints to control for diurnal expression patterns

The experimental design should include multiple timepoints during heat stress exposure and recovery periods to capture the dynamic regulation of GHR expression. Additionally, researchers should consider the behavioral adaptations of Bos indicus cattle, as their heightened reactivity compared to Bos taurus may confound stress measurements if handling procedures are not standardized.

How do GHR polymorphisms interact with STAT5A genotypes to influence growth and carcass traits in Bos indicus cattle?

The interaction between GHR and STAT5A represents a complex genetic relationship that significantly impacts growth and development in Bos indicus cattle. Research indicates that specific genotype combinations of these genes create synergistic effects on growth parameters. When analyzing these interactions, researchers should employ multivariate approaches:

  • Evaluate two-way and three-way gene interactions using factorial ANOVA designs

  • Assess genotype combinations across the GH signaling pathway (GHR, STAT5A, PIT1, GHRH)

  • Consider multiple growth traits simultaneously using principal component analysis to reduce dimensionality

Data reveals specific interaction patterns where combined genotypes show non-additive effects:

GHRSTAT5ABWWW 205YW 365ADG 1ADG 2
AACT (51)26.49 ± 5.98111.61 ± 21.54254.60 ± 106.900.43 ± 0.100.70 ± 0.29
AGCT (18)27.76 ± 4.30111.33 ± 25.44257.20 ± 98.000.42 ± 0.130.70 ± 0.27

This data suggests that the CT genotype of STAT5A can modulate the effects of different GHR genotypes, potentially through altered downstream signaling efficiency . When designing studies exploring these interactions, researchers should implement systems biology approaches that capture the entirety of the signaling pathway rather than focusing on isolated genes.

What genomic approaches can be used to investigate the evolutionary divergence of GHR between Bos indicus and Bos taurus lineages?

Investigating the evolutionary divergence of GHR between cattle subspecies requires sophisticated genomic approaches that can capture both sequence and structural variations. Researchers should consider:

  • Whole-genome sequencing (WGS) with minimum 30X coverage to identify all relevant variants

  • Selective sweep analysis to identify signatures of selection around the GHR locus

  • Runs of homozygosity (ROH) analysis to detect regions under selection pressure:

    • Focus on ROH segments in the 1-4 Mb range (83.33% of segments) and 4-8 Mb range (16.67%)

    • Pay special attention to chromosomes known to harbor GHR and related pathway genes (BTA1, BTA6, BTA14)

  • Comparative genomics approaches aligning GHR sequences across multiple bovine subspecies and related ruminants

  • Haplotype phasing and analysis to reconstruct the evolutionary history of key variants

When interpreting results, researchers should account for the confounding effects of artificial selection in domesticated lineages versus natural selection in wild populations. The analysis should also consider the genomic inbreeding coefficient (FROH) which can be calculated using the formula:

FROH = LROH / LAuto

Where LROH is the entire length of ROH in the genome and LAuto is the length of the autosomal genome . This approach provides insights into the genetic architecture underlying subspecies differences in GHR function and evolution.

How can CRISPR-Cas9 technology be optimized for editing Bos indicus GHR for functional studies?

CRISPR-Cas9 gene editing represents a cutting-edge approach for functional studies of GHR in Bos indicus, but requires specific optimizations compared to Bos taurus systems. Researchers implementing this technology should:

  • Design guide RNAs (gRNAs) specific to Bos indicus GHR sequences, accounting for subspecies-specific polymorphisms

  • Optimize transfection protocols for Bos indicus cell lines, which typically require modified conditions:

    • Higher voltage settings for electroporation (typically 1.5-1.8 kV)

    • Adjusted cell density (1.5-2.0 × 10⁶ cells/mL)

    • Modified recovery media composition with heat-stress protective factors

  • Implement a hierarchical validation strategy:

    • Initial validation in cell culture systems

    • Ex vivo validation in primary tissue explants

    • In vivo validation in embryo models before full animal studies

  • Consider off-target effects specific to the Bos indicus genome using computational prediction tools calibrated for zebu cattle

When designing functional studies using edited cells/animals, researchers should include appropriate wild-type controls from the same genetic background and implement multiple independent edited lines to control for insertion/deletion variability. The readout systems should capture both direct GHR signaling (STAT5 phosphorylation) and downstream physiological effects (IGF-1 production, cellular proliferation).

What are the best practices for measuring GHR-mediated signaling in primary Bos indicus tissues?

Measuring GHR-mediated signaling in primary Bos indicus tissues presents several technical challenges that require specialized approaches. Researchers should implement:

  • Rapid tissue collection protocols (ideally <30 minutes post-mortem) to preserve phosphorylation states

  • Modified tissue preservation methods that account for the higher environmental temperatures often encountered when working with Bos indicus:

    • Flash freezing in liquid nitrogen

    • Preservation in phosphatase inhibitor cocktails optimized for higher temperature stability

  • Western blotting with phospho-specific antibodies targeting:

    • JAK2 phosphorylation (Tyr1007/1008)

    • STAT5 phosphorylation (Tyr694/699)

    • ERK1/2 phosphorylation (Thr202/Tyr204)

  • Quantitative PCR for downstream gene expression with carefully validated reference genes specific to Bos indicus tissues

When comparing signaling responses between Bos indicus and Bos taurus tissues, researchers should standardize protocols to minimize variability and consider the intrinsic differences in baseline receptor expression and turnover rates. Additionally, ex vivo tissue culture systems should be optimized with media formulations that maintain tissue viability under conditions that mimic the physiological environment of Bos indicus cattle.

How can researchers address the challenges of behavioral reactivity in Bos indicus cattle during experimental procedures?

The heightened reactivity of Bos indicus cattle presents unique challenges for experimental design that can impact physiological measurements including GHR expression and function. Research indicates that Bos indicus breeds exhibit more intense antipredator responses than Bos taurus breeds when exposed to handling and novel environments . To address these challenges:

  • Implement habituation protocols before experimental procedures:

    • Gradual exposure to handling facilities (minimum 3-5 sessions)

    • Consistent handling personnel throughout the study

    • Positive reinforcement approaches during handling

  • Monitor and account for stress indicators:

    • Baseline cortisol levels in unstressed animals: ~3.92 ± 1.20 ng/mL

    • Expected reduction with habituation: ~1.67 ng/mL

    • Consider social rank effects: high-ranking animals maintain higher cortisol levels (6.4 ± 1.2 ng/mL) compared to low-ranking animals (0.5 ± 0.1 ng/mL)

  • Design specialized restraint and sampling protocols:

    • Minimize restraint duration (<2 minutes if possible)

    • Use group housing to reduce social stress

    • Consider remote sampling technologies where feasible

When interpreting results, researchers should acknowledge that stress-induced hormonal changes may confound measurements of GH-IGF axis function. Statistical analysis should include behavioral reactivity scores as covariates to account for inter-individual variation in stress responses.

What quality control measures are essential when working with recombinant Bos indicus GHR proteins in binding studies?

Working with recombinant Bos indicus GHR proteins requires rigorous quality control to ensure experimental reliability. Researchers should implement:

  • Expression system selection appropriate for mammalian glycoproteins:

    • Mammalian cell lines (HEK293 or CHO) for proper post-translational modifications

    • Baculovirus-insect cell systems for higher yield with acceptable glycosylation

  • Comprehensive protein characterization:

    • SDS-PAGE and Western blotting for size and immunoreactivity

    • Mass spectrometry for sequence confirmation and modification mapping

    • Circular dichroism for secondary structure verification

    • Dynamic light scattering for aggregation assessment

  • Functional validation:

    • Surface plasmon resonance (SPR) for binding kinetics

    • Cell-based reporter assays for signaling capacity

    • Competitive binding assays against standard preparations

  • Stability testing under experimental conditions:

    • Temperature sensitivity profiles (particularly important for Bos indicus proteins adapted to higher temperatures)

    • Freeze-thaw stability assessment

    • Long-term storage stability monitoring

When designing binding studies, researchers should account for the specific binding characteristics of Bos indicus GHR, including potential differences in pH optimum, cation requirements, and temperature sensitivity compared to Bos taurus proteins. Experiments should include appropriate positive controls (e.g., commercially validated Bos taurus GHR preparations) and negative controls (e.g., denatured receptor preparations).

How might single-cell RNA sequencing advance our understanding of GHR expression heterogeneity in Bos indicus tissues?

Single-cell RNA sequencing (scRNA-seq) offers unprecedented opportunities to understand cellular heterogeneity in GHR expression patterns within Bos indicus tissues. This approach enables:

  • Identification of cell type-specific GHR expression profiles within complex tissues like liver, muscle, and adipose

  • Discovery of novel cell populations with differential responsiveness to GH signaling

  • Characterization of developmental trajectories in GHR expression during growth phases

  • Mapping of complete GH-responsive transcriptional networks at single-cell resolution

To implement this approach effectively, researchers should:

  • Optimize tissue dissociation protocols specifically for Bos indicus tissues, which may require modified enzymatic digestion parameters

  • Implement computational pipelines capable of detecting splice variants and isoforms of GHR

  • Integrate spatial transcriptomics to maintain tissue context information

  • Correlate single-cell expression patterns with genotype information at the GHR locus

This technology would be particularly valuable for understanding the tissue-specific effects of GHR polymorphisms and their impact on growth and metabolic traits in Bos indicus cattle.

What potential exists for developing Bos indicus-specific growth hormone receptor agonists or antagonists for research applications?

The development of subspecies-specific GHR modulators represents an emerging frontier in Bos indicus research. Such tools would enable precise manipulation of GHR signaling in experimental settings, offering advantages for:

  • Mechanistic studies of growth regulation without confounding feedback effects

  • Investigation of tissue-specific GHR functions through targeted delivery

  • Evaluation of GHR as a potential therapeutic target for production-limiting conditions

  • Assessment of compensatory mechanisms in response to GHR inhibition

Development strategies should focus on:

  • Structure-based design leveraging the unique binding interface of Bos indicus GHR

  • Peptide mimetics targeting the extracellular domain with subspecies specificity

  • Small molecule modulators of downstream signaling components

  • Bispecific antibodies capable of differential binding to Bos indicus vs. Bos taurus GHR

Researchers pursuing this direction should implement rigorous specificity testing to ensure selective targeting of Bos indicus GHR over related receptors in the cytokine receptor family, and validate the functional effects in relevant cell and tissue systems.

How can integrative genomics approaches better elucidate the relationship between GHR variants and adaptive traits in Bos indicus populations?

Integrative genomic approaches offer powerful frameworks for connecting GHR genetic variation to adaptive traits in Bos indicus cattle. Future research should focus on:

  • Combining whole-genome sequencing with environmental data to identify climate adaptation signatures around the GHR locus

  • Implementing genome-wide association studies (GWAS) with high-density SNP panels optimized for Bos indicus populations

  • Integrating multiple data layers:

    • Genomic variation (SNPs, CNVs, structural variants)

    • Epigenetic modifications (particularly in regulatory regions)

    • Transcriptomic responses to environmental challenges

    • Metabolomic profiles linked to growth efficiency

  • Employing runs of homozygosity (ROH) analysis to detect selection signatures:

    • Focus on the significant homozygous regions identified on BTA1, BTA6, and BTA14

    • Assess ROH patterns across diverse Bos indicus populations to distinguish universal from population-specific adaptations

As noted in recent research, future studies should incorporate "comparative studies with other Bos indicus populations, long-term studies combining genomic data with environmental and livestock management information to understand inbreeding dynamics and its impact on productivity, conservation strategies to preserve genetic diversity and reducing the risk of inbreeding" . This integrative approach will provide a more comprehensive understanding of how GHR genetic architecture contributes to the unique adaptability of Bos indicus cattle to challenging environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.