Recombinant Bos javanicus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Role and Function of Cytochrome c Oxidase Subunit 2 (MT-CO2)

MT-CO2 is a mitochondrial DNA (mtDNA)-encoded subunit of the cytochrome c oxidase complex (Complex IV) . This complex plays a pivotal role in the electron transport chain, catalyzing the transfer of electrons from cytochrome c to molecular oxygen, and is the sole binding partner with cytochrome c and is the first recipient of its electrons . This process generates a proton gradient across the inner mitochondrial membrane, which drives ATP synthesis .

MT-CO2 binds to cytochrome c and contains the CuA center, which is composed of two copper atoms coordinated with six ligands . The protein facilitates the transfer of electrons to oxygen, which is the terminal electron acceptor in the respiratory chain .

Production and Characteristics of Recombinant MT-CO2

Recombinant MT-CO2 is produced using in vitro E. coli expression systems . This involves inserting the MT-CO2 gene from Bos javanicus into a bacterial plasmid, transforming E. coli with this plasmid, and culturing the bacteria to produce the protein .

Key characteristics of recombinant MT-CO2:

  • Source: Produced in vitro E. coli expression system

  • Purity: High purity, ensuring reliable results in experiments

  • Applications: Suitable for ELISA assays and antibody production

Research Applications

Recombinant MT-CO2 is used in various research applications, including:

  • ELISA assays: For detecting and quantifying MT-CO2 levels in biological samples

  • Antibody production: For generating antibodies specific to MT-CO2, useful in immunohistochemistry and Western blotting

  • Studies of mitochondrial function: Investigating the role of MT-CO2 in electron transport chain activity and ATP production

  • Evolutionary studies: Analyzing the sequence and structure of MT-CO2 in different species to understand evolutionary relationships

Mutations and Diseases

Mutations in the MT-CO2 gene are associated with several mitochondrial diseases . These mutations can impair the function of the cytochrome c oxidase complex, leading to reduced ATP production and various clinical manifestations, including myopathy and lactic acidosis .

A study identified a novel heteroplasmic mutation in the initiation codon of the MT-CO2 gene in a family with mitochondrial disease . This mutation resulted in lower levels of the protein and mitochondrial dysfunction .

Role in Greenhouse Gas Emissions

Research has shown that improving feed quality for livestock could potentially keep ECH4 emissions constant and reduce pressure on land and other resources .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Bos javanicus (Wild banteng)
Target Names
Target Protein Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, comprising heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular weight and basic biochemical properties of recombinant Bos javanicus MT-CO2?

The recombinant Bos javanicus MT-CO2 protein has a molecular weight of approximately 25.6 kDa. When produced as a recombinant protein with an N-terminal His tag, it typically demonstrates greater than 90% purity as determined by SDS-PAGE. The protein is generally provided as a lyophilized powder and can be reconstituted in a Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term stability, storage in 50% glycerol is recommended to maintain protein integrity.

What are the optimal storage and handling conditions for recombinant Bos javanicus MT-CO2?

For optimal storage of recombinant Bos javanicus MT-CO2:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration, with 50% being optimal) before aliquoting

  • Store working aliquots at 4°C for up to one week

  • For extended storage, keep aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

Before reconstitution, briefly centrifuge the vial to bring contents to the bottom. After reconstitution, create multiple small aliquots to minimize damage from freeze-thaw cycles during experimental use.

How can researchers effectively express and purify MT-CO2 for functional studies?

Effective expression and purification of MT-CO2 for functional studies involves several critical steps:

  • Expression System Selection: Escherichia coli is commonly used for MT-CO2 expression, as demonstrated in the available recombinant products. This system allows for high yield and relatively simple purification protocols.

  • Vector Construction: The MT-CO2 gene should be cloned with an appropriate tag (commonly His-tag) to facilitate purification. The full coding sequence (positions 1-227) should be included to ensure complete functional properties.

  • Optimization of Expression Conditions:

    • Temperature: Typically 25-30°C

    • Induction conditions: IPTG concentration and induction timing

    • Growth media: Enriched media for higher yields

  • Purification Protocol:

    • Lyse cells in appropriate buffer containing protease inhibitors

    • Perform affinity chromatography using the His-tag

    • Consider additional purification steps (ion exchange, size exclusion) if higher purity is required

    • Assess purity via SDS-PAGE (target >90%)

  • Functional Validation:

    • Spectroscopic analysis to confirm proper folding and cofactor incorporation

    • Electron transfer activity assays to confirm functionality

For the CuA site to form properly, copper supplementation may be required during expression or reconstitution steps.

What methodologies can be used to study electron transfer mechanisms in recombinant MT-CO2?

Studying electron transfer mechanisms in recombinant MT-CO2 requires sophisticated approaches:

  • Spectroscopic Techniques:

    • UV-Vis spectroscopy to monitor the CuA center's redox state

    • Electron paramagnetic resonance (EPR) spectroscopy to characterize the copper center's electronic structure

    • Resonance Raman spectroscopy to examine metal-ligand interactions

  • Kinetic Analysis Methods:

    • Stopped-flow spectroscopy to measure rapid electron transfer rates

    • Steady-state kinetic assays using artificial electron donors

    • Oxygen consumption measurements to assess complete electron transfer to O₂

  • Structural Analysis Combined with Functional Studies:

    • Site-directed mutagenesis of conserved residues (particularly at positions 196, 200, and 204) to assess their contribution to electron transfer rates

    • X-ray crystallography or cryo-EM to correlate structure with function

    • Molecular dynamics simulations to understand electron tunneling pathways

  • Comparative Studies:

    • Analysis of electron transfer rates between Bos javanicus MT-CO2 and other mammalian cytochrome c oxidase subunit 2 variants

    • Cross-species compatibility studies with various cytochrome c donors

A multi-method approach combining these techniques provides the most comprehensive understanding of electron transfer mechanisms.

How can researchers investigate interactions between MT-CO2 and other components of the respiratory chain?

Investigating interactions between MT-CO2 and other respiratory chain components involves several methodological approaches:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation (Co-IP) with tagged MT-CO2

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

    • Bioluminescence resonance energy transfer (BRET) for in vivo interaction studies

  • Complex Assembly Analysis:

    • Blue native PAGE to examine intact respiratory complexes

    • Density gradient centrifugation to isolate complex IV with MT-CO2

    • Chemical cross-linking followed by mass spectrometry to map interaction interfaces

  • Functional Coupling Experiments:

    • Reconstitution of MT-CO2 with other cytochrome c oxidase subunits in liposomes

    • Measurement of proton pumping efficiency when MT-CO2 interacts with different partners

    • Oxygen consumption rates in reconstituted systems

  • Structural Studies of Interfaces:

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

    • Cryo-EM of assembled complexes to visualize molecular interfaces

    • Computational molecular docking to predict interaction sites

The critical interaction to study is between MT-CO2 and cytochrome c, as MT-CO2 contains the primary binding site for cytochrome c and mediates electron transfer from this mobile electron carrier.

What can sequence comparison of MT-CO2 across bovine species reveal about evolutionary conservation and adaptation?

Sequence comparison of MT-CO2 across bovine species provides valuable insights into evolutionary patterns:

  • Conservation Analysis:

    • Multiple sequence alignment (MSA) of MT-CO2 from Bos javanicus, Bos taurus, and other bovine species reveals highly conserved functional domains, particularly around the CuA center (positions 196, 200, and 204)

    • Conservation scores at each amino acid position can identify critical functional residues versus those under less selective pressure

  • Selection Pressure Analysis:

    • Calculate the ratio of nonsynonymous to synonymous substitutions (ω) across the sequence

    • Most codons in MT-CO2 typically show strong purifying selection (ω << 1), indicating the critical nature of this protein

    • Approximately 4% of sites may evolve under relaxed selective constraint (ω = 1)

  • Structural-Functional Correlation:

    • Map sequence variations onto the three-dimensional structure to identify if variations cluster in particular regions

    • Analyze whether variations affect protein-protein interaction surfaces versus core structural elements

  • Adaptation Analysis:

    • Examine whether sequence variations correlate with ecological adaptations (e.g., altitude, temperature ranges of habitats)

    • Investigate whether mutations in MT-CO2 co-evolve with changes in nuclear-encoded respiratory chain components

Studies on other species, like the marine copepod Tigriopus californicus, demonstrate that despite MT-CO2's critical function, significant interpopulation sequence divergence (up to 20% at the nucleotide level) can exist, suggesting that compensatory co-evolution with interacting proteins may drive some of this variation.

How do functional studies of recombinant MT-CO2 help understand mitochondrial-nuclear genome co-evolution?

Functional studies of recombinant MT-CO2 provide key insights into mitochondrial-nuclear genome co-evolution:

  • Compatibility Testing:

    • Reconstitution experiments combining MT-CO2 from one species with nuclear-encoded cytochrome c oxidase subunits from another species

    • Measurement of electron transfer rates and oxygen consumption to assess functional compatibility

    • Analysis of whether decreased function correlates with evolutionary distance

  • Hybrid Dysfunction Studies:

    • Creation of chimeric proteins containing domains from different species to pinpoint regions critical for compatibility

    • Assessment of whether specific amino acid substitutions can rescue hybrid dysfunction

    • Correlation of laboratory findings with natural hybrid fitness in the wild

  • Co-evolutionary Rate Analysis:

    • Comparison of evolutionary rates between MT-CO2 and its interacting nuclear-encoded partners

    • Testing for correlated substitution patterns that may indicate compensatory mutations

    • Analysis of whether regions with direct physical interactions show stronger co-evolutionary signals

  • Functional Consequences of Variation:

    • Measurement of catalytic efficiency, thermal stability, and pH optima of MT-CO2 variants

    • Assessment of whether variations affect assembly efficiency with other subunits

    • Investigation of potential trade-offs between different functional parameters

Research on marine copepods has demonstrated that hybrid dysfunction between populations with divergent MT-CO2 sequences can be directly linked to reduced fitness, suggesting that mitonuclear co-evolution is a significant driver of population divergence and potentially speciation.

What are common challenges in working with recombinant MT-CO2 and how can they be addressed?

Researchers face several challenges when working with recombinant MT-CO2:

  • Protein Solubility Issues:

    • Challenge: MT-CO2 contains transmembrane domains, making it prone to aggregation.

    • Solution: Use mild detergents (DDM, CHAPS) during purification; optimize detergent:protein ratios; consider fusion partners that enhance solubility; purify at 4°C to reduce aggregation.

  • Proper Folding and Cofactor Incorporation:

    • Challenge: Ensuring correct incorporation of the CuA center.

    • Solution: Supplement expression media with copper; consider slow refolding protocols; verify proper folding through spectroscopic analysis of the CuA center's characteristic absorption spectrum.

  • Stability During Storage:

    • Challenge: Activity loss during storage.

    • Solution: Store with 50% glycerol at -80°C; avoid repeated freeze-thaw cycles; prepare small working aliquots; consider lyophilization for long-term storage.

  • Functional Assay Development:

    • Challenge: Developing assays that specifically measure MT-CO2 activity.

    • Solution: Use purified cytochrome c as electron donor; monitor spectral changes at wavelengths specific to copper center oxidation/reduction; optimize buffer conditions to maintain physiological activity.

  • Interaction with Membrane Environments:

    • Challenge: Replicating the native membrane environment for functional studies.

    • Solution: Reconstitute purified MT-CO2 into liposomes with defined lipid composition; use nanodiscs for a more controlled membrane mimetic environment; ensure proper orientation in the membrane.

How can researchers distinguish between artifacts and genuine results when studying recombinant MT-CO2?

Distinguishing between artifacts and genuine results requires rigorous experimental design and controls:

  • Expression System Artifacts:

    • Issue: Post-translational modifications may differ between E. coli and eukaryotic systems.

    • Control: Compare results between different expression systems; verify key findings in native mitochondrial preparations when possible.

  • Tag Interference:

    • Issue: His-tags or other fusion tags may affect function or interactions.

    • Control: Compare tagged and tag-cleaved versions of the protein; place tags at different positions (N- vs C-terminal); use different tag types to confirm results are tag-independent.

  • Buffer and Detergent Effects:

    • Issue: Non-physiological buffer components may alter activity.

    • Control: Test multiple buffer conditions; validate key findings in conditions that most closely mimic physiological environments; perform detergent titration experiments.

  • Protein Quality Assessment:

    • Issue: Partially degraded or improperly folded protein can give misleading results.

    • Control: Rigorously assess protein quality by SDS-PAGE, size exclusion chromatography, and spectroscopic methods; compare activity between fresh and stored protein preparations.

  • Statistical Validation:

    • Issue: Random variations may be misinterpreted as significant findings.

    • Control: Perform experiments with biological replicates (different protein preparations); use appropriate statistical tests; establish significance thresholds before experiments.

  • Literature Comparison:

    • Issue: Results may conflict with published findings.

    • Control: Directly compare experimental conditions to those in published work; attempt to reproduce key findings from literature as positive controls in your system.

What emerging techniques might advance our understanding of MT-CO2 structure-function relationships?

Several emerging techniques show promise for advancing MT-CO2 research:

  • Cryo-Electron Microscopy Advances:

    • High-resolution structural determination of MT-CO2 in complex with other respiratory chain components

    • Time-resolved cryo-EM to capture different conformational states during the catalytic cycle

    • Visualization of MT-CO2 within the complete cytochrome c oxidase complex in native membrane environments

  • Single-Molecule Techniques:

    • Single-molecule FRET to monitor conformational changes during electron transfer

    • Optical tweezers combined with electrical measurements to correlate mechanical changes with electron transfer events

    • Single-molecule electrophysiology to measure electron movement through individual protein complexes

  • Advanced Computational Methods:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations of electron transfer through the CuA center

    • Machine learning approaches to predict functional consequences of sequence variations

    • Molecular dynamics simulations with polarizable force fields for more accurate modeling of metal centers

  • Genetic and Genomic Approaches:

    • CRISPR-based screening to identify novel interacting partners of MT-CO2

    • Massively parallel mutagenesis combined with functional selection to create comprehensive maps of mutational effects

    • Comparative genomics across diverse bovine populations to identify adaptive variations

  • In Vivo Imaging Techniques:

    • Development of spectrally distinct probes for real-time monitoring of MT-CO2 activity in living cells

    • Super-resolution microscopy to visualize MT-CO2 distribution and dynamics within mitochondria

    • Correlative light and electron microscopy to link functional states with ultrastructural features

How might studies of MT-CO2 contribute to understanding mitochondrial diseases and aging?

Research on MT-CO2 has significant implications for understanding mitochondrial pathologies:

  • Pathogenic Mutation Analysis:

    • Recombinant MT-CO2 provides a platform for testing the functional consequences of disease-associated mutations

    • Comparative studies between wild-type and mutant forms can reveal mechanisms of pathogenicity

    • Structure-function analyses can help predict the severity of novel variants

  • Aging Research Applications:

    • Investigation of whether post-translational modifications of MT-CO2 accumulate with age

    • Analysis of whether age-related decline in cytochrome c oxidase activity correlates with specific changes in MT-CO2

    • Examination of whether interventions that extend lifespan affect MT-CO2 function

  • Oxidative Stress Mechanisms:

    • Studies on how oxidative damage affects MT-CO2 structure and function

    • Investigation of whether MT-CO2 variants differ in their susceptibility to oxidative damage

    • Development of assays to measure MT-CO2 dysfunction as a biomarker of mitochondrial stress

  • Therapeutic Development Platforms:

    • Screening for compounds that can stabilize or restore function to compromised MT-CO2

    • Testing whether peptides derived from MT-CO2 can modulate cytochrome c oxidase activity

    • Development of gene therapy approaches targeting MT-CO2 dysfunction

  • Evolutionary Medicine Perspectives:

    • Analysis of whether certain MT-CO2 variants that are adaptive in specific environments may become maladaptive in others (e.g., with dietary or climate changes)

    • Investigation of population-specific MT-CO2 variants that may influence disease susceptibility

    • Comparative studies across species with different lifespans to identify longevity-associated features

Understanding the fundamental aspects of MT-CO2 function provides crucial insights into both basic mitochondrial biology and the pathophysiology of mitochondrial diseases, potentially opening new avenues for therapeutic intervention in conditions characterized by respiratory chain dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.