Recombinant Bos mutus grunniens ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Biological Role of MT-ATP6

MT-ATP6 is a mitochondrial DNA-encoded subunit of ATP synthase (Complex V), which catalyzes ATP production via oxidative phosphorylation . Key functions:

  • Proton translocation: Forms part of the F₀ sector, enabling proton flow across the inner mitochondrial membrane .

  • Energy coupling: Converts proton gradient energy into ATP synthesis in the F₁ sector .

  • Pathogenic mutations: Over 20 mutations in MT-ATP6 are linked to mitochondrial disorders (Table 1) .

Clinical Implications of MT-ATP6 Mutations

Pathogenic variants disrupt ATP synthase assembly, proton channel efficiency, or stability, leading to:

  • Leigh syndrome: Severe neurodegenerative disorder with >90% heteroplasmy levels .

  • NARP syndrome (Neuropathy, Ataxia, Retinitis Pigmentosa): Milder symptoms at 70–90% heteroplasmy .

  • Bilateral striatal necrosis: Motor deficits and microcephaly .

Table 1: Key MT-ATP6 Mutations and Functional Impacts

MutationClinical PresentationFunctional DefectReferences
m.8993T>G (p.L156R)Leigh syndrome/NARP90% drop in ATP synthesis; impaired proton flow
m.9176T>GDevelopmental delayReduced ATP synthesis; normal holoenzyme
m.9185T>CMitochondrial membrane defectsImpaired proton pumping; low membrane potential
m.8843T>C (p.I106T)Ataxia, muscle weaknessCompromised ATP synthase assembly

Mechanistic Insights from Recombinant Protein Studies

  • Yeast models: The aL173R mutation (equivalent to human aL156R) reduces ATP synthesis by 90%, mimicking human pathologies . Revertants (e.g., aR173W) partially restore function by stabilizing subunit interactions .

  • Structural analysis: Mutations in helix aH4 (e.g., aL156R) distort the proton channel, while substitutions in aH5 (e.g., aT178A) affect rotor-stator interactions .

  • Biochemical assays: Recombinant MT-ATP6 enables direct testing of proton flux efficiency and inhibitor responses .

Applications in Biomedical Research

  1. Drug screening: Used to evaluate compounds targeting ATP synthase in mitochondrial diseases .

  2. Mutation characterization: Facilitates functional studies of novel MT-ATP6 variants .

  3. Antibody production: Serves as an antigen for developing diagnostics targeting ATP synthase defects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Bos mutus grunniens (Wild yak) (Bos grunniens)
Target Names
Target Protein Sequence
MNENLFASFITPMILGLPLVTLIVLFPSLLFPTSDRLVNNRFVTLQQWMLQLVSKQMMSI HNPKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAISLWAGAVITGFRNK TKTSLAHFLPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLA LMSISATTALITFIILILLTILEFAVAMIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembranous catalytic core, F1, and the membrane proton channel, F0, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. Subunit a is a key component of the proton channel, potentially playing a direct role in proton transmembrane translocation.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (MT-ATP6)?

ATP synthase subunit a is a membrane-embedded component of the F₀ domain of ATP synthase. It functions alongside the c-ring to shuttle protons across the inner mitochondrial membrane, driving the rotary mechanism that powers ATP synthesis.

Recent high-resolution structural studies have revealed that ATP synthase is composed of typically 17 different protein subunits organized into a membrane-extrinsic F₁ catalytic domain and a membrane-embedded F₀ domain, connected by peripheral and central stalks . Subunit a (MT-ATP6), together with the c-ring (consisting of identical c subunits), forms the proton channel that converts the proton gradient energy into mechanical rotation, ultimately leading to ATP production .

The MT-ATP6 gene is located in mitochondrial DNA between nucleotide positions 8527 to 9207 in humans, and it belongs to the mitochondrial respiratory chain complex family . This highly conserved protein is essential for maintaining the structural integrity and functional efficiency of the ATP synthase complex, which operates with a remarkable efficiency rate of approximately 90% .

How conserved is MT-ATP6 across bovine species, and what are the key differences in the yak variant?

The MT-ATP6 gene shows significant conservation across bovine species, though with important species-specific variations. Comparative analysis reveals that the nucleotide composition in bovine mitochondrial genomes is generally biased toward adenine and thymine, with AT content typically around 60.7% and GC content around 39.3% .

A notable structural feature conserved across bovine species including yak is the overlapping region between ATP synthase F0 subunit 8 (atp8) and ATP synthase F0 subunit 6 (atp6), which spans approximately 40 bp . This overlapping arrangement is believed to play a role in coordinated expression and assembly of these subunits.

Species-specific amino acid substitutions in MT-ATP6 can affect protein function and stability. These differences may represent evolutionary adaptations to different environmental conditions, particularly in high-altitude species like Bos mutus grunniens (yak), which must maintain efficient energy production under hypoxic conditions.

What expression systems are most effective for producing recombinant MT-ATP6?

For recombinant MT-ATP6 expression, cell-free expression systems have proven particularly effective due to the hydrophobic nature and transmembrane topology of this protein . These systems circumvent the toxicity often associated with overexpression of membrane proteins in cellular systems.

Alternative approaches include:

Expression SystemAdvantagesLimitationsYield (mg/L)
Cell-free systemAvoids toxicity issues, rapid productionHigher cost, potential folding issues1-5
E. coli with fusion tagsCost-effective, scalableOften forms inclusion bodies, requires refolding0.5-3
Insect cell systemsBetter folding of complex proteinsHigher cost, longer production time2-8
Mammalian cell expressionNative-like post-translational modificationsHighest cost, low yield0.5-2

When working with recombinant MT-ATP6, researchers should be aware that the protein may become entrapped in the seal of product vials during shipment and storage . Appropriate storage and handling protocols are essential to maintain protein integrity.

How can researchers effectively study the impact of point mutations in recombinant MT-ATP6?

Studying point mutations in recombinant MT-ATP6 requires a multi-faceted approach that combines molecular biology techniques with functional assays. High-resolution melt (HRM) analysis followed by DNA sequencing has proven effective for detecting specific mutations, such as the m.9176T>G mutation associated with Leigh syndrome .

For functional characterization of mutations, researchers can employ:

  • ATP synthesis assays: Measure ATP production rates using luciferase-based assays in reconstituted systems or isolated mitochondria expressing the mutant protein.

  • Proton translocation assays: Utilize pH-sensitive fluorescent probes to assess the impact of mutations on proton translocation efficiency.

  • Rotational catalysis analysis: Advanced biophysical techniques such as single-molecule FRET can be used to measure the effects of mutations on the rotational mechanism of ATP synthase.

  • Structural analysis: Cryo-EM structures provide valuable insights into how specific mutations may disrupt protein-protein interactions or alter the conformation of critical functional domains .

When analyzing heteroplasmic mutations (where both wild-type and mutant mtDNA coexist), researchers should quantify the mutation load using techniques such as pyrosequencing or digital droplet PCR to establish genotype-phenotype correlations .

What are the optimal conditions for assessing the enzymatic activity of recombinant MT-ATP6 in experimental settings?

Optimal assessment of recombinant MT-ATP6 enzymatic activity requires careful consideration of experimental conditions that mimic the physiological environment while enabling precise measurements. Key parameters include:

Buffer composition:

  • pH: 7.2-7.4 (physiological mitochondrial matrix pH)

  • Ionic strength: 120-150 mM KCl

  • Mg²⁺: 5-10 mM (essential cofactor for ATP synthesis)

  • Pi: 5-10 mM (substrate for ATP synthesis)

  • ADP: 0.2-1 mM (substrate for ATP synthesis)

Membrane reconstitution:
For functional studies, MT-ATP6 must be properly incorporated into a membrane environment. Proteoliposomes containing the complete ATP synthase complex provide the most physiologically relevant system. Alternative approaches include nanodiscs or amphipol-stabilized preparations.

Proton gradient establishment:
The proton motive force (PMF) can be established either through:

  • pH gradient (ΔpH): Create using acid-base transitions

  • Membrane potential (Δψ): Generate using K⁺/valinomycin

  • Combined approach: Most physiologically relevant

Activity measurement techniques:

  • Luciferase-based ATP production assays

  • Spectrophotometric assays coupling ATP production to NADH oxidation

  • ³²P-labeled ATP synthesis monitoring

  • Proton translocation monitoring using pH-sensitive fluorophores

The oligomerization state of ATP synthase significantly impacts its activity, with dimers and higher-order oligomers showing enhanced function compared to monomers . Therefore, researchers should consider the oligomeric state when designing experimental systems.

How can researchers differentiate between direct inhibition of MT-ATP6 and secondary effects on ATP synthase activity?

Differentiating between direct inhibition of MT-ATP6 and secondary effects on ATP synthase requires systematic experimental approaches:

  • Site-specific binding assays: Utilize labeled ATP synthase inhibitors with known binding sites to determine whether the inhibition involves direct interaction with MT-ATP6 or other subunits.

  • Mutagenesis studies: Introduce specific mutations in MT-ATP6 and assess whether they alter inhibitor sensitivity. Resistance to particular inhibitors following mutation suggests direct interaction.

  • Proton translocation assays: Since MT-ATP6 forms part of the proton channel, specific inhibition would affect proton translocation. Measuring proton flux independently from ATP synthesis can help distinguish between effects on the proton channel versus the catalytic site.

  • Rotational analysis: Single-molecule techniques can determine whether inhibition affects the rotation of the c-ring (suggesting MT-ATP6 involvement) or other aspects of ATP synthase function.

  • Comparative inhibition profiles: Test multiple known inhibitors with different binding sites:

Inhibitor ClassPrimary Binding SiteEffect on MT-ATP6Secondary Effects
OligomycinF₀ sector (c-ring)Blocks proton translocationMinimal secondary effects
Aurovertinβ-subunit of F₁Minimal direct effectInhibits conformational changes
ResveratrolF₁ sectorMinimal direct effectAffects catalytic site
Bz-423OSCP subunitMinimal direct effectInduces ROS production

Over 300 natural and synthetic ATP synthase inhibitors have been identified, each with reported inhibitory sites and suggested modes of action . Understanding their specific mechanisms can help distinguish direct MT-ATP6 effects from secondary consequences.

What are the known pathological mutations in MT-ATP6 and how do they compare across species?

Numerous pathological mutations in MT-ATP6 have been identified, with varying clinical presentations and severity. The most extensively studied include:

MutationAmino Acid ChangeAssociated SyndromeMolecular ConsequenceConservation in Bovines
m.8993T>GLeu156ArgNARP/Leigh syndromeImpairs proton channel functionHighly conserved position
m.9176T>GLeu217ArgLeigh syndromeAffects proton translocationConserved in Bos species
m.8993T>CLeu156ProNARP/Leigh (milder)Partial proton channel impairmentHighly conserved position
m.9185T>CLeu220ProNARP/LeighDisrupts protein structureModerately conserved

The m.9176T>G mutation has been specifically linked to Leigh syndrome, a progressive neurodegenerative mitochondrial disorder characterized by psychomotor regression . This heteroplasmic mutation results in an amino acid substitution of Leu to Arg in the ATP synthase subunit a, significantly impairing enzyme function .

Studies in bovine species, including yak, show conservation of these critical residues, suggesting that recombinant Bos mutus grunniens MT-ATP6 could serve as a valuable model for studying these pathological mutations. The degree of heteroplasmy (proportion of mutant to wild-type mtDNA) significantly influences the clinical phenotype, with higher mutation loads generally correlating with more severe manifestations .

How can recombinant MT-ATP6 be utilized to develop potential therapeutics for mitochondrial diseases?

Recombinant MT-ATP6 offers several avenues for therapeutic development for mitochondrial diseases:

  • Drug screening platform: Recombinant protein can be used to screen compound libraries for molecules that might stabilize mutant MT-ATP6 or enhance residual ATP synthase activity.

  • Structure-based drug design: High-resolution structural information from recombinant protein can guide the development of small molecules that might compensate for specific mutations.

  • Gene therapy models: Testing gene therapy approaches using wild-type MT-ATP6 in cellular and animal models to assess potential for functional rescue.

  • Allotopic expression systems: Developing nuclear-encoded, mitochondrially-targeted MT-ATP6 that could bypass mtDNA mutations.

  • Heteroplasmy shifting strategies: Utilizing CRISPR-based approaches to selectively eliminate mutant mtDNA molecules, potentially using recombinant MT-ATP6 studies to validate efficacy.

Research has shown that ATP synthase is not only crucial for ATP production but also harbors the permeability transition pore (PTP), implying that MT-ATP6-targeted therapies might additionally modulate cell death pathways relevant to disease manifestations .

What are the most reliable methods for studying MT-ATP6 protein-protein interactions within the ATP synthase complex?

Studying protein-protein interactions involving MT-ATP6 requires specialized approaches due to its hydrophobic nature and membrane localization:

  • Crosslinking mass spectrometry (XL-MS): Particularly effective for capturing transient or dynamic interactions. Chemical crosslinkers with varying spacer lengths can provide distance constraints between MT-ATP6 and neighboring subunits.

  • Cryo-electron microscopy (cryo-EM): Recent advances have enabled high-resolution structures of complete ATP synthase, including precise mapping of MT-ATP6 interactions with other subunits .

  • Co-immunoprecipitation with specifically designed detergent mixtures: Careful selection of mild detergents can solubilize the complex while preserving physiologically relevant interactions.

  • FRET-based interaction assays: Fluorescently labeled MT-ATP6 variants can reveal dynamic interactions during the catalytic cycle.

  • Genetic complementation studies: Yeast models with MT-ATP6 mutations can be complemented with recombinant variants to assess functional interactions.

Research has demonstrated that MT-ATP6 interacts extensively with the c-ring to form the proton channel, as well as with other membrane-embedded subunits such as subunit 8 (A6L), with which it shares an overlapping genetic region in the mitochondrial genome . These interactions are critical for both structural stability and the functional mechanics of proton translocation.

What quality control parameters should researchers monitor when working with recombinant MT-ATP6?

Ensuring the quality of recombinant MT-ATP6 preparations requires monitoring several critical parameters:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (>95% purity recommended)

    • Western blotting with specific antibodies

    • Mass spectrometry to confirm protein identity and detect potential contaminants

  • Structural integrity:

    • Circular dichroism to verify secondary structure elements

    • Fluorescence spectroscopy to assess tertiary structure

    • Limited proteolysis to evaluate proper folding

  • Functional validation:

    • Proton translocation activity in reconstituted systems

    • ATP synthesis capability when incorporated into proteoliposomes with other ATP synthase subunits

    • Oligomycin sensitivity as a measure of proper folding and assembly

  • Stability monitoring:

    • Thermal shift assays to determine protein stability

    • Time-course activity measurements under storage conditions

    • Aggregation analysis using dynamic light scattering

When working with recombinant transmembrane proteins like MT-ATP6, researchers should be aware that small volumes of protein may occasionally become entrapped in the seal of product vials during shipment and storage, potentially affecting protein recovery and experimental reproducibility .

How can researchers effectively compare recombinant MT-ATP6 function across different bovine species?

Comparative functional analysis of MT-ATP6 across bovine species requires standardized approaches:

  • Sequence and structural alignment:

    • Multiple sequence alignment to identify conserved and variable regions

    • Homology modeling based on available structures to visualize species-specific differences

    • Phylogenetic analysis to establish evolutionary relationships

  • Expression systems standardization:

    • Use identical expression conditions for all species variants

    • Verify equivalent protein folding and stability

    • Confirm proper membrane insertion in reconstitution systems

  • Functional assays under varying conditions:

    • ATP synthesis rates under standard conditions

    • Proton translocation efficiency measurements

    • Response to varying pH, temperature, and membrane potential

    • Inhibitor sensitivity profiles

  • Adaptive value assessment:

    • Test function under conditions mimicking species-specific environments (e.g., high-altitude conditions for yak MT-ATP6)

    • Measure thermodynamic parameters across variants

    • Evaluate stress resistance (oxidative, thermal, pH)

The mitochondrial genomes of bovine species typically show positive AT skew (0.104) and negative GC skew (-0.319), indicating higher content of adenine and cytosine than their respective complementary nucleotides . This nucleotide bias may influence codon usage and potentially protein expression levels, which should be considered when comparing recombinant proteins from different species.

How might studying recombinant MT-ATP6 contribute to understanding mitochondrial evolution in bovine species?

The study of recombinant MT-ATP6 from different bovine species offers unique insights into mitochondrial evolution:

  • Adaptive evolution analysis: Comparing MT-ATP6 sequences and functions across bovine species adapted to different environments (e.g., high-altitude yaks vs. lowland cattle) can reveal selection pressures driving mitochondrial evolution.

  • Structure-function relationships: Identifying species-specific amino acid substitutions and their functional consequences can illuminate how environmental adaptations are achieved at the molecular level.

  • Hybrid compatibility studies: Investigating the function of chimeric ATP synthase complexes containing MT-ATP6 from one species and other subunits from different species can reveal co-evolutionary constraints.

  • Mitochondrial-nuclear compatibility: Analysis of interaction between recombinant MT-ATP6 variants and nuclear-encoded ATP synthase subunits can provide insights into mitonuclear co-evolution.

The overlapping genetic architecture of ATP8 and ATP6 genes (with a 40 bp overlap) represents a conserved feature across bovine species , suggesting important evolutionary constraints on the expression and coordination of these two ATP synthase components.

What emerging technologies might enhance our ability to study MT-ATP6 function and dynamics?

Several cutting-edge technologies are poised to revolutionize MT-ATP6 research:

  • Single-molecule imaging techniques: Advanced fluorescence methods capable of visualizing individual ATP synthase molecules during operation can provide unprecedented insights into MT-ATP6's role in proton translocation and rotary catalysis.

  • Nanoscale electrode arrays: Direct measurement of proton movements through the MT-ATP6/c-ring channel at unprecedented temporal resolution.

  • Cryo-electron tomography: Visualization of ATP synthase in its native mitochondrial membrane environment, revealing physiologically relevant oligomeric states and membrane deformations.

  • Optogenetic approaches: Light-controlled proton pumps to precisely manipulate the proton gradient driving ATP synthase, allowing time-resolved functional studies.

  • Advanced computational methods: Molecular dynamics simulations incorporating quantum effects to model proton movement through the MT-ATP6 channel with atomic precision.

  • CRISPR-based mitochondrial genome editing: Precise introduction of mutations in MT-ATP6 to study their functional consequences in cellular and animal models.

The remarkable efficiency of ATP synthase (approximately 90%) suggests sophisticated molecular mechanisms that warrant investigation with these advanced technologies. Recent studies on the electric field within ATP synthase have revealed that alterations in this field support proton movement and ATP formation, demonstrating that the enzyme operates beyond its biological catalytic role .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.