Recombinant Bos mutus grunniens Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Bos mutus grunniens (Wild yak) (Bos grunniens)
Target Names
Target Protein Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Uniprot No.

Target Background

Function

Recombinant Bos mutus grunniens Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multisubunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center (in subunit 2) and heme a (in subunit 1) to the binuclear center (BNC) in subunit 1. This BNC, composed of heme a3 and CuB, reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Cytochrome c oxidase subunit 2 (MT-CO2) and what is its role in cellular respiration?

    MT-CO2 (also abbreviated as COII, COX2, or MTCO2) is the second subunit of cytochrome c oxidase, which forms part of Complex IV in the mitochondrial respiratory chain. It is encoded by the mitochondrial DNA (mtDNA) gene MT-CO2 and plays a crucial role in cellular respiration.

    MT-CO2 is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase, which is crucial for ATP production during cellular respiration . The protein contains a binuclear copper A center (CuA) located in a conserved cysteine loop at positions 196 and 200, and a conserved histidine at position 204 . These structures are essential for its electron transfer function.

  • How does yak MT-CO2 differ structurally from that of other bovine species?

    Yak (Bos grunniens/Bos mutus) MT-CO2 shares significant homology with other bovine species but exhibits specific differences. In research on the Yanglong yak (Bos grunniens), the complete mitochondrial genome analysis revealed that while the gene order is identical to previously published mitochondrial genomes of its congeners, there are distinct phylogenetic relationships .

    The MT-CO2 protein typically consists of 227 amino acids with a molecular weight of approximately 25.6 kDa in mammals . In yaks, the mitochondrial genome encodes MT-CO2 as part of its 13 protein-coding genes, alongside 22 tRNA and 2 rRNA genes within a genome of approximately 16,323 bp .

  • Why is yak MT-CO2 particularly interesting for evolutionary and adaptation studies?

    Yak MT-CO2 is of particular interest because yaks have adapted to living in high-altitude, cold, and hypoxic environments. The oxygen transfer functions of cytochrome c oxidase are crucial for survival in low-oxygen conditions, making MT-CO2 a potential target of adaptive evolution.

    Studies have shown that yaks have developed unique respiratory mechanisms for survival in these harsh conditions. For instance, comparisons between yaks and cattle from the Qinghai-Tibetan plateau revealed significant differences in their methanogen community structures , which may relate to differences in their respiratory systems and energy metabolism pathways.

Experimental Design Questions

  • What purification strategies are most effective for recombinant yak MT-CO2?

    Purification of recombinant yak MT-CO2 typically involves:

    1. Affinity chromatography: Using histidine tags (His-tags) for purification via Ni²⁺-binding affinity chromatography .

    2. Size exclusion chromatography: For further purification based on protein size.

    3. Ion exchange chromatography: To separate based on charge differences.

    4. Detergent solubilization: Since MT-CO2 is a membrane protein, appropriate detergents are necessary for extraction and maintaining protein structure.

    A typical purification workflow might include:

    StepMethodPurpose
    1Cell lysisRelease of recombinant protein
    2Membrane fractionationIsolation of membrane-bound MT-CO2
    3Detergent solubilizationExtraction of MT-CO2 from membranes
    4Affinity chromatographyCapture of His-tagged MT-CO2
    5Size exclusion chromatographyRemoval of aggregates and contaminants
    6Quality controlVerification of purity and activity
  • How can researchers assess the structural integrity of purified recombinant MT-CO2?

    Several methods can be employed to assess the structural integrity of purified recombinant MT-CO2:

    • Circular Dichroism (CD) spectroscopy: To evaluate secondary structure content.

    • Fluorescence spectroscopy: To assess tertiary structure and environment of aromatic residues.

    • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): To determine the oligomeric state and homogeneity.

    • Mass spectrometry: For accurate mass determination and identification of post-translational modifications.

    • Differential Scanning Calorimetry (DSC): To measure thermal stability.

    • Limited proteolysis: To assess accessibility of protease cleavage sites, providing information on protein folding.

    For membrane proteins like MT-CO2, techniques that can be applied in the presence of detergents or lipids are particularly valuable.

  • What are the key considerations for designing mutation studies in yak MT-CO2?

    When designing mutation studies for yak MT-CO2, researchers should consider:

    1. Conservation analysis: Identify conserved residues across species by sequence alignment. The copper A center residues (cysteines at positions 196 and 200, histidine at position 204) are particularly important.

    2. Structural information: Use available structural data from homologous proteins to predict the impact of mutations.

    3. Functional domains: Focus on regions involved in electron transfer or interactions with other subunits.

    4. Mutation strategy:

      • Site-directed mutagenesis for targeted changes

      • Alanine scanning for systematic analysis

      • Conservative vs. non-conservative substitutions

    5. Expression system compatibility: Ensure the chosen expression system can accommodate the mutations.

    6. Functional assays: Develop appropriate assays to measure the effect of mutations on activity.

    Studies of MT-CO2 in other species have identified codons under strong purifying selection (ω << 1) and others under relaxed selective constraint (ω = 1) , which can guide mutation design.

Data Analysis and Interpretation Questions

  • How can researchers interpret variations in MT-CO2 sequences across yak populations?

    Interpretation of MT-CO2 sequence variations across yak populations requires:

    1. Population genetics analyses:

      • Calculate nucleotide and haplotype diversity

      • Perform selective neutrality tests

      • Conduct mismatch distribution analysis for demographic history

    2. Molecular evolution analyses:

      • Estimate nonsynonymous to synonymous substitution ratios (ω)

      • Apply codon substitution models to identify selection patterns

      • Use branch-site models to detect lineage-specific selection

    3. Functional prediction:

      • Assess the potential impact of amino acid substitutions on protein function

      • Map variations to functional domains and interaction sites

    Previous studies on wild yak (Bos grunniens mutus) have revealed rich genetic diversity with nucleotide diversity of 0.024430 ± 0.012685 and haplotype diversity of 0.9619 ± 0.0260 . Analysis of 21 mtDNA D-loop sequences identified 45 variable sites and 15 haplotypes, with phylogenetic analysis revealing two distinct lineages .

  • What bioinformatic approaches are useful for comparative analysis of yak MT-CO2 with other species?

    Several bioinformatic approaches are valuable for comparative analysis:

    1. Sequence alignment tools:

      • MUSCLE or CLUSTAL for multiple sequence alignment

      • T-COFFEE for consistency-based alignments

    2. Phylogenetic analysis software:

      • PhyML for maximum likelihood tree construction

      • MrBayes for Bayesian inference

      • PAML for detecting natural selection

    3. Protein structure prediction and comparison:

      • AlphaFold for structure prediction

      • PyMOL or UCSF Chimera for structural visualization and comparison

    4. Selection analysis tools:

      • PAML's codeml for detecting positive selection

      • HyPhy for sophisticated selection analysis

      • MEME for detecting episodic selection

    5. Visualization tools:

      • Jalview for visualizing sequence alignments

      • FigTree for displaying phylogenetic trees

    These approaches can reveal evolutionary relationships and functional adaptations in yak MT-CO2 compared to other bovine species.

  • How can recombinant MT-CO2 be used to study high-altitude adaptation in yaks?

    Recombinant MT-CO2 provides valuable tools to study high-altitude adaptation in yaks:

    1. Enzyme kinetics comparisons:

      • Measure oxygen affinity (Km) of yak vs. lowland cattle MT-CO2

      • Compare electron transfer rates under varying oxygen concentrations

      • Assess thermal stability and pH optima differences

    2. Structural studies:

      • Determine if structural differences exist that enhance oxygen binding

      • Identify any adaptations in the copper binding site

    3. Reconstitution experiments:

      • Create chimeric enzyme complexes with subunits from different species

      • Determine which domains confer high-altitude adaptation

    4. Cellular studies:

      • Express recombinant yak MT-CO2 in cellular models

      • Measure respiratory efficiency under hypoxic conditions

    5. Directed evolution experiments:

      • Subject recombinant MT-CO2 to selection under hypoxic conditions

      • Identify mutations that enhance function under low oxygen

    These approaches can reveal molecular mechanisms underlying the yak's remarkable adaptation to high-altitude environments with low oxygen availability.

Technical Challenges and Solutions

  • What are the main challenges in expressing functional recombinant MT-CO2 and how can they be addressed?

    Expression of functional recombinant MT-CO2 faces several challenges:

    ChallengeSolution
    Membrane protein expressionUse specialized expression systems like C41(DE3) E. coli strains; consider cell-free expression systems
    Proper foldingExpress at lower temperatures (16-20°C); use chaperone co-expression systems
    Copper center formationSupplement growth media with copper; consider periplasmic expression in bacteria
    Integration with other subunitsCo-express with other cytochrome c oxidase subunits; use bicistronic or polycistronic expression systems
    Post-translational modificationsUse eukaryotic expression systems (yeast, insect, or mammalian cells)
    Toxicity to host cellsUse tightly controlled inducible promoters; optimize expression conditions
    Protein solubilityScreen multiple detergents for extraction; consider fusion tags that enhance solubility

    Addressing these challenges requires a systematic approach, often involving testing multiple expression systems and conditions to identify optimal parameters for functional expression.

  • How can researchers troubleshoot problems with recombinant yak MT-CO2 activity assays?

    When troubleshooting activity assays for recombinant yak MT-CO2, consider:

    1. Protein quality issues:

      • Verify protein integrity by SDS-PAGE and western blot

      • Check for degradation using mass spectrometry

      • Assess oligomeric state using native PAGE or size exclusion chromatography

    2. Assay conditions optimization:

      • Test multiple pH conditions (typically pH 6.5-8.0)

      • Vary buffer composition (phosphate vs. HEPES vs. Tris)

      • Optimize salt concentration

      • Test different detergents or lipid compositions

    3. Substrate quality:

      • Use freshly prepared reduced cytochrome c

      • Verify the reduction state spectrophotometrically

      • Consider commercial vs. in-house prepared substrates

    4. Detection sensitivity:

      • Use more sensitive detection methods if necessary

      • Consider coupled enzyme assays to amplify signal

      • Optimize spectrophotometer settings

    5. Control experiments:

      • Include positive controls (e.g., commercial cytochrome c oxidase)

      • Run parallel assays with well-characterized homologs

      • Include appropriate negative controls

    Systematic troubleshooting can help identify the source of problems and lead to successful activity measurements.

  • What are the current limitations in computational modeling of yak MT-CO2 and how might they be overcome?

    Computational modeling of yak MT-CO2 faces several limitations:

    1. Limited structural data:

      • Solution: Use homology modeling based on related structures; incorporate experimental constraints from biochemical studies

      • Future direction: Obtain experimental structures using cryo-EM or X-ray crystallography

    2. Membrane environment complexity:

      • Solution: Use more sophisticated membrane models in molecular dynamics simulations

      • Future direction: Develop integrated models that account for lipid-protein interactions

    3. Multi-subunit complex modeling:

      • Solution: Model individual subunits and then dock them together

      • Future direction: Simulate the entire cytochrome c oxidase complex

    4. Electron transfer dynamics:

      • Solution: Use quantum mechanical/molecular mechanical (QM/MM) approaches

      • Future direction: Develop specialized force fields for metal centers

    5. Computational resource limitations:

      • Solution: Use coarse-grained models for large-scale simulations

      • Future direction: Leverage high-performance computing resources and specialized hardware

    Overcoming these limitations will require interdisciplinary approaches combining computational modeling with experimental validation to iteratively improve models.

Emerging Research Directions

  • How might recombinant yak MT-CO2 contribute to carbon dioxide removal research?

    While current carbon dioxide removal (CDR) technologies focus on different approaches such as metal-organic frameworks for capturing CO2 , enzymes involved in cellular respiration like MT-CO2 could potentially contribute to future biomimetic CDR strategies:

    1. Enzyme-based carbon capture:

      • MT-CO2 functions in the respiratory chain that ultimately reduces oxygen to water

      • Understanding this mechanism could inspire artificial systems for CO2 conversion

    2. Comparative studies with high-altitude adapted species:

      • Yaks living in high-altitude environments may have evolved unique respiratory properties

      • These adaptations could inform efficient oxygen utilization systems with lower CO2 production

    3. Biocatalyst development:

      • Recombinant MT-CO2 could be studied as part of engineered biocatalytic systems

      • These systems might be deployed in bioreactors for carbon capture

    4. Integration with artificial photosynthesis:

      • Components of the respiratory chain could potentially be reverse-engineered

      • This could contribute to artificial photosynthesis systems that convert CO2 to useful compounds

    As global efforts to develop CDR technologies intensify, with a goal of removing gigatons of CO2 annually , biologically-inspired approaches may become increasingly important, making foundational research on respiratory enzymes like yak MT-CO2 valuable.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.