Recombinant Boselaphus tragocamelus Cytochrome c oxidase subunit 2 (MT-CO2)

What is Boselaphus tragocamelus Cytochrome c oxidase subunit 2 (MT-CO2)?

MT-CO2 (mitochondrially encoded cytochrome c oxidase II) is an essential component of the respiratory chain complex IV in mitochondria. In Boselaphus tragocamelus (nilgai antelope), this protein functions as part of the electron transport chain, specifically in the cytochrome c oxidase complex. The protein contributes to cytochrome-c oxidase activity and is involved in mitochondrial electron transport from cytochrome c to oxygen, playing a crucial role in cellular respiration . The recombinant form of this protein is synthesized for research purposes and maintains the functional domains of the native protein while allowing for controlled experimental applications.

What is the amino acid sequence and structure of Boselaphus tragocamelus MT-CO2?

The amino acid sequence of Boselaphus tragocamelus MT-CO2 is: MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWTVPSLGLKTDAIPGRLNQTTLMSTRPGLYYGQCSEICGSNHSFMPIVIELVPLKYFEKWASML . The protein has a transmembrane structure with the first N-terminal membrane-spanning region being particularly important for its function and interaction with other subunits. Mutations in this membrane-spanning region can disrupt protein function, as demonstrated in human disease models .

What is the biological function of MT-CO2 in Boselaphus tragocamelus?

MT-CO2 in Boselaphus tragocamelus, like in other mammals, contributes to cytochrome-c oxidase activity, which is essential for aerobic respiration. It is involved in mitochondrial electron transport, transferring electrons from cytochrome c to oxygen, the final step in the electron transport chain. Additionally, it contributes to the positive regulation of vasoconstriction . In Boselaphus tragocamelus, an herbivore with a ruminal digestive system that consumes significant plant material , efficient mitochondrial function is crucial for energy production to support their metabolic demands.

How can researchers study the interaction between MT-CO2 and other subunits of the cytochrome c oxidase complex?

Researchers can employ multiple complementary approaches to study interactions between MT-CO2 and other cytochrome c oxidase subunits:

• Co-immunoprecipitation: Using antibodies specific to MT-CO2 to pull down the protein and its interacting partners, followed by mass spectrometry or immunoblotting to identify associated subunits.

• Cross-linking studies: Chemical cross-linking followed by proteomics analysis can capture transient interactions and identify proximity relationships between MT-CO2 and other subunits.

• Immunoblot analysis: As demonstrated in studies of COX mutations, immunoblotting with antibodies directed against multiple COX subunits can reveal how alterations in MT-CO2 affect the stability of other subunits. Research has shown that mutations in COX II can lead to reduced levels of not only COX II but also other subunits, including COX I, COX III, and nuclear-encoded subunits Vb, VIa, VIb, and VIc .

• Structural biology techniques: X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy can provide atomic-level details of subunit interfaces.

These methodologies allow for comprehensive analysis of both direct physical interactions and functional dependencies between MT-CO2 and other components of the respiratory complex.

What experimental approaches can be used to assess the functional impact of MT-CO2 mutations?

To assess the functional impact of MT-CO2 mutations, researchers can implement a multi-faceted experimental approach:

This comprehensive approach enables researchers to connect genetic alterations to specific biochemical and physiological consequences.

How can researchers investigate species-specific differences in MT-CO2 function between Boselaphus tragocamelus and other mammals?

To investigate species-specific differences in MT-CO2 function across mammals, researchers should consider:

• Comparative sequence analysis: Align MT-CO2 sequences from Boselaphus tragocamelus and other species to identify conserved domains and species-specific variations. This bioinformatic approach can highlight evolutionarily significant regions.

• Heterologous expression systems: Express MT-CO2 from different species in standardized cellular backgrounds to directly compare functional parameters while controlling for other variables.

• Chimeric protein analysis: Create chimeric proteins containing domains from MT-CO2 of different species to map functional differences to specific protein regions.

• In vitro reconstitution experiments: Reconstitute cytochrome c oxidase complexes using MT-CO2 from different species combined with standardized subunits to isolate species-specific functional differences.

• Molecular dynamics simulations: Computational approaches can predict how species-specific amino acid differences might affect protein dynamics and interactions.

This multi-method approach allows researchers to identify both subtle and significant functional adaptations in MT-CO2 across different mammalian lineages, potentially correlating with metabolic adaptations or environmental pressures.

What are the optimal conditions for working with recombinant Boselaphus tragocamelus MT-CO2 in laboratory settings?

For optimal handling of recombinant Boselaphus tragocamelus MT-CO2 in laboratory settings, researchers should follow these methodological guidelines:

• Storage conditions: Store the recombinant protein at -20°C for routine storage, and at -80°C for extended storage periods. Avoid repeated freeze-thaw cycles as they can compromise protein integrity. Working aliquots can be stored at 4°C for up to one week .

• Buffer composition: The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability. When designing experiments, consider buffer compatibility with your assay systems.

• Temperature sensitivity: Maintain the protein at 4°C during experimental procedures, as cytochrome c oxidase activity can be temperature-sensitive.

• Reducing agents: Include mild reducing agents like DTT or β-mercaptoethanol at low concentrations (0.5-1 mM) to maintain native disulfide bonds while preventing non-specific oxidation.

• Metal ion considerations: Since MT-CO2 is part of a metalloprotein complex, avoid chelating agents that might sequester essential metal ions.

• pH conditions: Maintain a pH range of 7.2-7.5 for most experimental applications to mimic physiological conditions while preserving protein stability.

These conditions ensure maximum retention of protein structure and function for accurate experimental outcomes.

What techniques can be used to assess the quality and activity of recombinant MT-CO2?

To comprehensively assess recombinant MT-CO2 quality and activity, researchers should employ multiple complementary techniques:

• SDS-PAGE and western blotting: Evaluate protein purity, integrity, and identity using antibodies specific to MT-CO2 or any included tags.

• Circular dichroism spectroscopy: Assess secondary structure composition to confirm proper protein folding.

• Cytochrome c oxidase activity assay: Measure electron transfer rates using reduced cytochrome c as substrate and monitoring its oxidation spectrophotometrically at 550 nm.

• Thermal shift assays: Determine protein stability under various conditions by monitoring unfolding as a function of temperature.

• Mass spectrometry: Confirm protein identity, detect post-translational modifications, and assess sample homogeneity.

• Spectrophotometric analysis: Evaluate heme incorporation by scanning absorbance between 400-650 nm to detect characteristic Soret and α/β bands of the heme groups.

• Polarographic measurements: Quantify oxygen consumption rates in reconstituted systems containing the recombinant protein.

This multi-parameter assessment provides a comprehensive profile of protein quality and functional activity before proceeding with experimental applications.

How can researchers effectively incorporate recombinant Boselaphus tragocamelus MT-CO2 into ELISA-based detection systems?

For effective incorporation of recombinant Boselaphus tragocamelus MT-CO2 into ELISA-based detection systems, researchers should follow this methodological approach:

• Coating optimization: Determine the optimal concentration of recombinant MT-CO2 for plate coating (typically 1-5 μg/ml) in carbonate/bicarbonate buffer (pH 9.6). Perform checkerboard titrations to establish the minimal concentration that provides maximum signal.

• Blocking protocol: Test different blocking agents (BSA, milk proteins, commercial blockers) at various concentrations (1-5%) to minimize non-specific binding while preserving antigen accessibility.

• Antibody selection and validation:

  • For direct detection: Use validated anti-MT-CO2 antibodies with demonstrated specificity

  • For sandwich ELISA: Use complementary antibody pairs recognizing different epitopes

  • Validate antibody specificity against recombinant MT-CO2 and potential cross-reactive proteins

• Signal development optimization:

  • Compare different enzyme conjugates (HRP, AP) for optimal sensitivity

  • Test various substrate systems to achieve the desired detection range

  • Establish standard curves using purified recombinant MT-CO2

• Quality control measures:

  • Include positive and negative controls in each assay

  • Establish intra- and inter-assay coefficients of variation (<10% and <15%, respectively)

  • Determine the lower limit of detection and quantification

• Cross-reactivity assessment: Evaluate potential cross-reactivity with MT-CO2 from closely related species to determine assay specificity.

This systematic approach ensures development of sensitive and specific ELISA systems for MT-CO2 detection in research applications.

How does Boselaphus tragocamelus MT-CO2 compare structurally and functionally to MT-CO2 from domestic cattle?

Structural and functional comparison between Boselaphus tragocamelus (nilgai) and domestic cattle MT-CO2 reveals both similarities and differences:

Despite their taxonomic relationship, these species have distinct ecological niches—nilgai being wild herbivores adapted to resource-limited environments , while domestic cattle have undergone centuries of artificial selection for productive traits. These different evolutionary pressures may be reflected in subtle structural variations in MT-CO2 that could affect electron transport efficiency or oxygen affinity, potentially contributing to differences in metabolic efficiency between species. Research comparing in vitro digestibility between these species shows similar digestive efficiency , suggesting conserved metabolic pathways despite ecological differences.

What can comparative analysis of MT-CO2 across bovid species reveal about evolutionary adaptations in mitochondrial function?

Comparative analysis of MT-CO2 across bovid species provides valuable insights into evolutionary adaptations in mitochondrial function:

These comparative approaches enable researchers to understand how mitochondrial function has evolved in response to different ecological pressures within the Bovidae family, providing insights into both fundamental mitochondrial biology and adaptive evolution.

How do experimental models using Boselaphus tragocamelus MT-CO2 compare with those using human MT-CO2 for studying mitochondrial disorders?

When comparing experimental models using Boselaphus tragocamelus MT-CO2 versus human MT-CO2 for studying mitochondrial disorders, researchers should consider these methodological distinctions:

In studying mitochondrial disorders like MELAS syndrome , human MT-CO2 models provide direct clinical relevance, while Boselaphus tragocamelus models offer complementary insights, potentially revealing conserved mechanisms of protein function and disease pathogenesis. The experimental value of nilgai MT-CO2 comes from both its similarities to and differences from the human protein, providing a comparative lens through which to understand fundamental aspects of mitochondrial function across mammalian species.

What insights can research on Boselaphus tragocamelus MT-CO2 provide about human mitochondrial disorders?

Research on Boselaphus tragocamelus MT-CO2 can provide valuable insights into human mitochondrial disorders through several mechanisms:

• Structural conservation analysis: Key functional domains in MT-CO2 are conserved across mammals. Studies of nilgai MT-CO2 structure can illuminate how these domains function in humans, particularly regions involved in assembly of the cytochrome c oxidase complex and interactions with other subunits like COX I, which are critical for stabilizing heme a3 binding .

• Evolutionary robustness mapping: Comparing MT-CO2 sequences across species can identify evolutionarily robust regions where mutations are likely to be pathogenic in any mammal, including humans. Mutations in the first N-terminal membrane-spanning region, for example, have been shown to cause severe dysfunction in humans .

• Novel compensatory mechanisms: Nilgai and other bovids may possess species-specific compensatory mechanisms that mitigate the effects of potentially harmful MT-CO2 variants. Identifying these mechanisms could suggest therapeutic strategies for human mitochondrial disorders.

• Biomarker development: MT-CO2 serves as a biomarker for conditions like Huntington's disease and stomach cancer . Comparative studies using nilgai MT-CO2 could help refine understanding of how MT-CO2 changes correlate with disease states.

• Functional assay development: Recombinant nilgai MT-CO2 can be used to develop in vitro assays for assessing the impact of mutations found in human patients, potentially offering complementary systems for characterizing variants of uncertain significance in human MT-CO2.

By providing an evolutionary and comparative context, research on nilgai MT-CO2 contributes to a deeper understanding of fundamental mechanisms underlying human mitochondrial disorders, potentially revealing new therapeutic targets or diagnostic approaches.

How can mutations in MT-CO2 affect the assembly and stability of the cytochrome c oxidase complex?

Mutations in MT-CO2 can significantly impact cytochrome c oxidase complex assembly and stability through multiple mechanisms:

These mechanisms illustrate the critical role of MT-CO2 in maintaining the structural and functional integrity of the entire cytochrome c oxidase complex, explaining why mutations in this subunit can have widespread effects on respiratory chain function.

What methodological approaches can be used to study the effects of MT-CO2 dysfunction on cellular bioenergetics?

To comprehensively study the effects of MT-CO2 dysfunction on cellular bioenergetics, researchers should employ a multi-faceted methodological approach:

• Oxygen consumption analysis:

  • High-resolution respirometry to measure changes in oxygen consumption rates

  • Substrate-inhibitor titrations to assess specific respiratory chain complexes

  • Calculation of respiratory control ratios to evaluate coupling efficiency

• ATP production assessment:

  • Luminescence-based ATP quantification assays

  • ATP/ADP ratio measurements using enzymatic cycling methods

  • Real-time ATP production monitoring using genetic reporters

• Membrane potential evaluation:

  • Potentiometric dyes (e.g., TMRM, JC-1) to assess mitochondrial membrane potential

  • Time-resolved analysis of membrane potential fluctuations

  • Correlation of membrane potential with respiratory chain activity

• Metabolic flux analysis:

  • 13C-labeled substrate tracing to map metabolic pathway alterations

  • Extracellular flux analysis to measure glycolytic and oxidative metabolism

  • Metabolomics profiling to identify accumulated or depleted metabolites

• ROS production measurement:

  • Fluorescent probes (e.g., DCF, MitoSOX) to quantify reactive oxygen species

  • Antioxidant enzyme activity assays to assess cellular responses

  • Oxidative damage markers (protein carbonylation, lipid peroxidation)

• Histochemical and immunological techniques:

  • COX/SDH double staining to identify cytochrome c oxidase-deficient cells

  • Immunohistochemistry to assess subunit expression patterns

  • Analysis of mitochondrial network morphology

This systematic approach provides comprehensive insights into how MT-CO2 dysfunction affects multiple aspects of cellular energy metabolism, oxidative stress responses, and compensatory mechanisms. In muscle tissue samples with severe COX deficiency, histochemical analyses have demonstrated increased SDH staining, representing a compensatory response to cytochrome c oxidase dysfunction .