Recombinant Bothriechis lateralis NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Description

Protein Identity and Structure

Recombinant Bothriechis lateralis NADH-ubiquinone oxidoreductase chain 4 (MT-ND4) is identified by the UniProt ID O03700 and is alternatively known as NADH dehydrogenase subunit 4 . This protein is encoded by the MT-ND4 gene (also referred to as MTND4, NADH4, or ND4) and represents a critical component of mitochondrial function . While the specific structure of Bothriechis lateralis MT-ND4 has not been fully characterized, insights can be drawn from homologous proteins in related species and humans.

The human homolog of MT-ND4 functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor . The protein is essential for both the catalytic activity and assembly of Complex I, highlighting its fundamental importance in cellular energy production . As a membrane-bound protein, MT-ND4 contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane, positioning it optimally for its role in the electron transport chain.

Enzymatic Activity

NADH-ubiquinone oxidoreductase chain 4 functions as part of the larger enzymatic complex classified as NADH:ubiquinone reductase (H⁺-translocating) with the Enzyme Commission number EC 7.1.1.2 (formerly EC 1.6.5.3) . The primary catalytic function involves:

  1. Oxidation of NADH to NAD⁺

  2. Transfer of electrons through iron-sulfur clusters to ubiquinone

  3. Coupling of this electron transfer to proton translocation across the inner mitochondrial membrane

This process contributes to the generation of the proton gradient that drives ATP synthesis, making MT-ND4 an integral component of cellular energy metabolism. While specific catalytic parameters for the Bothriechis lateralis MT-ND4 have not been extensively reported, its conservation across species suggests similar functional properties to homologs in other organisms.

Expression Systems

Recombinant Bothriechis lateralis NADH-ubiquinone oxidoreductase chain 4 can be expressed and purified from multiple host systems, each offering distinct advantages depending on the intended application . The primary expression systems include:

Table 1: Comparison of Expression Systems for Recombinant MT-ND4 Production

Host SystemAdvantagesDisadvantagesTypical YieldTurnaround Time
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modificationsHighShort
YeastGood yield, some post-translational modificationsMore complex than E. coliModerate-highModerate
Insect cells (Baculovirus)Better post-translational modificationsMore expensive, longer production timeModerateLonger
Mammalian cellsMost authentic post-translational modificationsLowest yield, most expensive, longest production timeLowLongest

Purification and Quality Control

Commercial recombinant Bothriechis lateralis MT-ND4 proteins typically achieve purities exceeding 85% as determined by SDS-PAGE analysis . The purification process often incorporates affinity chromatography using tag systems that are determined during the manufacturing process . The resulting product may be available in either full-length or partial forms, with both options serving different research applications .

Quality control measures for recombinant proteins typically include:

  1. SDS-PAGE analysis to confirm size and purity

  2. Western blotting to verify identity

  3. Activity assays to confirm functional integrity

  4. Mass spectrometry to validate protein sequence

Reconstitution Protocol

For optimal recovery of lyophilized recombinant MT-ND4, the following reconstitution protocol is recommended:

  1. Brief centrifugation of the vial prior to opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol to a final concentration of 5-50% to enhance stability for long-term storage

  4. Aliquoting of the reconstituted protein to minimize freeze-thaw cycles

The standard glycerol concentration used by manufacturers is typically 50%, which can serve as a reference point for laboratory preparations . Storage buffers may also contain Tris/PBS-based components and stabilizing agents such as trehalose (pH 8.0) to enhance protein stability .

Phylogenetic and Evolutionary Studies

The MT-ND4 gene has been extensively used in phylogenetic analyses of snake species, particularly within the Bothriechis genus . These analyses have contributed significantly to our understanding of evolutionary relationships among venomous snakes. In a noteworthy study, MT-ND4 gene sequences were used alongside other mitochondrial genes (cytochrome b) to identify and characterize a relict lineage of Bothriechis in Honduras, contributing to the taxonomic reclassification within this genus .

Researchers utilizing Bayesian inference and maximum likelihood approaches have successfully employed MT-ND4 sequence data to establish phylogenetic relationships among various Bothriechis species, including B. lateralis, B. marchi, B. thalassinus, and others . These molecular analyses have revealed unexpected relationships, such as the close genetic affinity between B. lateralis from Costa Rica/Panama and populations from northern Honduras .

Potential Biomedical Applications

Though not explicitly documented in the search results, recombinant proteins derived from venomous snakes have shown potential in various biomedical applications, including:

  1. Development of diagnostic tools

  2. Drug discovery platforms

  3. Exploration of novel enzymatic functions

  4. Study of mitochondrial disorders

The availability of recombinant Bothriechis lateralis MT-ND4 provides researchers with opportunities to explore these and other potential applications without the need for direct venom extraction from live specimens.

Applications and Limitations

Commercial recombinant Bothriechis lateralis MT-ND4 is primarily intended for research applications such as SDS-PAGE analysis, Western blotting, ELISA, and functional studies . These products are explicitly labeled as not intended for human consumption or therapeutic applications, reflecting their research-focused development .

The potential limitations of commercially available recombinant MT-ND4 include:

  1. Variability in activity based on expression system

  2. Potential differences in post-translational modifications compared to the native protein

  3. Limited functional data specific to the Bothriechis lateralis variant

  4. Restricted applications to in vitro research contexts

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Bothriechis lateralis (Side-striped palm pitviper)
Target Names
Target Protein Sequence
PIAGSMVLAAILLKLGGYGIIRMMQVLPTTKTEMFLPFLVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIIIQTPWGLSGAMALMVAHGFTSSSLFCLANTTYERTHTRILI LTRGFHNILPMATTWWLLANLLNIATPPSMNFTGELLIMSALFNWCPTTIILLGLSMLIT ASYSLHMFLSTQMGPTALSNQTAPMHSREHLLITLHLIPLMLISMKPELVI
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Bothriechis lateralis and why is its MT-ND4 protein significant for research?

Bothriechis lateralis (Side-striped palm pitviper) is a venomous snake species found in Costa Rica, particularly in cloud forest regions such as Monte Verde and San Ramón, Alajuela. This arboreal viper belongs to the Viperidae family and is characterized by its distinctive side striping1. The species has gained scientific interest not only for its venom properties but also for its genetic characteristics.

MT-ND4 (NADH-ubiquinone oxidoreductase chain 4) is a protein encoded by the mitochondrial genome that functions as part of Complex I in the electron transport chain. This protein plays a crucial role in cellular respiration and energy production. The significance of studying this protein from B. lateralis includes:

  • Evolutionary biology applications: MT-ND4 sequences are frequently used in phylogenetic analyses to understand evolutionary relationships among snake species .

  • Mitochondrial function studies: As a component of the electron transport chain, it provides insights into energy metabolism in venomous snakes.

  • Comparative biochemistry: Studying variations in this highly conserved protein across different species can reveal adaptive mechanisms.

  • Molecular ecology: MT-ND4 markers help in population genetics studies of these ecologically important predators.

How should recombinant MT-ND4 protein be stored and handled to maintain optimal stability?

Proper storage and handling of recombinant MT-ND4 protein is critical for experimental success. Based on manufacturer recommendations, researchers should follow these protocols:

  • Short-term storage (up to one week): Store working aliquots at 4°C .

  • Long-term storage: Keep at -20°C, with -80°C preferred for extended conservation periods .

  • Storage buffer composition: The protein is typically supplied in a Tris-based buffer with 50% glycerol, specifically optimized for this protein .

  • Avoid repeated freeze-thaw cycles as they significantly degrade protein quality and functional activity .

  • Before opening, briefly centrifuge the vial to bring contents to the bottom .

  • For reconstitution: Use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, then add glycerol to a final concentration of 5-50% before aliquoting for long-term storage .

The shelf life varies depending on storage form: approximately 6 months for liquid preparations at -20°C/-80°C, while lyophilized forms maintain stability for up to 12 months under the same conditions .

What experimental controls should be included when working with recombinant MT-ND4 in biochemical assays?

When designing experiments with recombinant MT-ND4, a robust set of controls is essential to ensure data validity and distinguish specific effects from artifacts:

  • Negative controls:

    • Empty vector/expression system preparations processed identically to the MT-ND4 sample

    • Heat-denatured MT-ND4 protein (95°C for 10 minutes) to confirm activity requires proper protein folding

    • Non-related protein of similar molecular weight and properties (e.g., another mitochondrial protein)

  • Positive controls:

    • Well-characterized homologous proteins from model organisms (when available)

    • Native Complex I preparations from conventional sources

    • Commercial NADH dehydrogenase preparations with verified activity

  • Specificity controls:

    • Activity assays with and without specific Complex I inhibitors (e.g., rotenone)

    • Substrate specificity tests using NADH analogs

    • Experiments with site-directed mutants affecting critical functional residues

  • Technical controls:

    • Buffer-only controls to establish baseline measurements

    • Concentration gradients to establish dose-dependent responses

    • Multiple biological and technical replicates to ensure reproducibility

  • Quality control checks:

    • SDS-PAGE analysis to verify protein purity (>85% as specified)

    • Western blot confirmation of protein identity

    • Activity measurements compared to predicted values based on enzyme classification (EC= 1.6.5.3)

What are the optimal conditions for reconstituting recombinant MT-ND4 for functional studies?

Reconstituting recombinant MT-ND4 for functional studies requires careful consideration of several parameters to maintain protein integrity and activity:

  • Initial preparation:

    • Centrifuge the protein vial briefly before opening to collect content at the bottom

    • Allow frozen protein to thaw gradually on ice to prevent thermal stress

  • Reconstitution buffer selection:

    • Base buffer: 20-50 mM Tris-HCl or phosphate buffer, pH 7.2-7.5

    • Salt concentration: 100-150 mM NaCl to maintain ionic strength

    • Stabilizing agents: 1-5 mM DTT or 2-mercaptoethanol to prevent oxidation of sulfhydryl groups

    • Consider adding specific lipids that interact with MT-ND4 in its native environment

  • Protein concentration optimization:

    • Recommended working concentration: 0.1-1.0 mg/mL

    • Higher concentrations may lead to aggregation due to hydrophobic interactions

    • Very low concentrations may result in protein adsorption to vessel surfaces

  • Membrane mimetic systems:

    • Detergent selection: Mild non-ionic detergents (DDM, LMNG, digitonin) at concentrations just above CMC

    • Lipid composition: Consider including cardiolipin which is abundant in mitochondrial membranes

    • Protein-to-lipid ratio: Start with 1:100 and optimize based on activity measurements

  • Reconstitution methods:

    • Detergent dialysis: Gradual removal of detergent over 24-48 hours

    • Direct dilution: For small-scale rapid assessment

    • Bio-bead adsorption: Controlled removal of detergent using hydrophobic beads

  • Functional verification:

    • NADH oxidation assay: Monitor decrease in absorbance at 340 nm

    • Electron transfer rates: Use artificial electron acceptors like ferricyanide

    • Protein orientation assessment: Use protease protection assays to verify topology

What approaches can be used to study the evolutionary conservation of MT-ND4 across different viperid species?

Studying evolutionary conservation of MT-ND4 across viperid species requires a systematic approach combining molecular techniques, bioinformatics, and comparative analyses:

  • Sample collection and DNA extraction:

    • Obtain tissue samples from multiple Bothriechis species and related viperids

    • Extract total DNA or mitochondrial DNA using specialized kits

    • Ensure proper documentation of specimen origins and voucher specimens

  • MT-ND4 amplification and sequencing:

    • Design primers targeting conserved regions flanking MT-ND4

    • Use PCR with high-fidelity polymerase to minimize errors

    • Apply both Sanger sequencing and next-generation sequencing approaches

    • Previous studies have successfully used MT-ND4 sequences for phylogenetic analysis

  • Sequence analysis pipeline:

    • Multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Visual inspection and manual correction of alignments

    • Identification of conserved domains versus variable regions

    • Calculate sequence identity and similarity matrices

  • Phylogenetic reconstruction:

    • Select appropriate evolutionary models (e.g., GTR+G+I for nucleotides)

    • Apply Maximum Likelihood and Bayesian Inference methods

    • Assess node support through bootstrapping or posterior probabilities

    • Include outgroups from related genera (e.g., Agkistrodon, Bothrops)

  • Selection pressure analysis:

    • Calculate non-synonymous/synonymous substitution ratios (dN/dS)

    • Identify sites under positive, negative, or neutral selection

    • Apply branch-site models to detect lineage-specific selection

  • Structure-function correlation:

    • Map conservation patterns onto structural models

    • Identify conserved functional motifs and catalytic sites

    • Correlate variation patterns with known functional domains

  • Comparative analysis with other mitochondrial genes:

    • Compare evolutionary rates with other mitochondrial genes (e.g., MT-CYB)

    • Test for co-evolution patterns with interacting proteins

    • Assess the relative conservation of MT-ND4 in the mitochondrial genome context

How can recombinant MT-ND4 be used to investigate potential connections between mitochondrial function and venom production in vipers?

Investigating the relationship between mitochondrial function and venom production represents an innovative research direction, with recombinant MT-ND4 serving as a valuable tool:

  • Energy metabolism in venom glands:

    • Compare MT-ND4 expression levels between venom gland and other tissues

    • Assess mitochondrial density and activity during different phases of venom production

    • Examine how venom production cycle correlates with changes in oxidative phosphorylation

  • In vitro experimental approaches:

    • Develop venom gland cell cultures or organoids

    • Introduce recombinant MT-ND4 variants via transfection

    • Monitor changes in venom component synthesis and secretion

    • Examine how mitochondrial function affects calcium signaling in secretory cells

  • Mitochondrial stress and venom composition:

    • Induce mitochondrial stress using specific inhibitors

    • Measure changes in venom protein synthesis and composition

    • Test whether specific venom components are more sensitive to energy constraints

  • Comparative studies across species:

    • Analyze MT-ND4 sequence variations across Bothriechis species

    • Correlate sequence polymorphisms with differences in venom composition

    • Examine whether MT-ND4 evolution correlates with venom evolution patterns

  • Functional mimicry experiments:

    • Replace endogenous MT-ND4 with recombinant variants in cell models

    • Assess impact on cellular energetics and protein synthesis capacity

    • Test whether specific MT-ND4 haplotypes confer advantages for high-demand secretory processes

  • Reactive oxygen species (ROS) connection:

    • Measure ROS production in venom gland mitochondria

    • Investigate whether ROS serves as signaling molecules in venom production

    • Test antioxidant interventions and their effects on venom synthesis

This research direction could provide novel insights into the metabolic demands of venom production and potentially reveal evolutionary adaptations in mitochondrial function that support the energetically expensive process of venom synthesis in Bothriechis lateralis1 .

What methodological approaches can be used to study the role of MT-ND4 in reactive oxygen species (ROS) production?

Investigating the role of MT-ND4 in reactive oxygen species (ROS) production requires sophisticated methodological approaches:

  • ROS detection methods:

    • Fluorescent probes:

      • H₂DCFDA for general intracellular ROS

      • MitoSOX Red for mitochondrial superoxide detection

      • Amplex Red for hydrogen peroxide quantification

    • Chemiluminescent assays:

      • Lucigenin for superoxide detection

      • Luminol for general ROS measurement

    • Electron Spin Resonance (ESR) spectroscopy with spin traps for most specific ROS identification

  • Experimental systems for MT-ND4 studies:

    • Reconstituted proteoliposomes:

      • Incorporate purified recombinant MT-ND4 into artificial membranes

      • Measure ROS production with varying substrate concentrations

      • Compare wild-type and mutant MT-ND4 variants

    • Isolated mitochondria supplementation:

      • Add recombinant MT-ND4 to MT-ND4-depleted mitochondrial preparations

      • Assess changes in ROS production patterns

  • Structure-function studies:

    • Site-directed mutagenesis of key residues in the amino acid sequence

    • Focus on regions likely involved in electron transfer

    • Measure changes in ROS production with different mutants

    • Correlate to structural models and conserved domains

  • Comparative approaches:

    • Compare ROS production between MT-ND4 from Bothriechis lateralis and other species

    • Assess whether venom-producing species show distinctive ROS production patterns

    • Investigate the relationship between MT-ND4 sequence variations and ROS generation

  • Inhibitor studies:

    • Use site-specific inhibitors of Complex I:

      • Rotenone (binds near iron-sulfur clusters)

      • Piericidin A (competes with ubiquinone)

      • DPI (flavin binding site inhibitor)

    • Map inhibitor sensitivity profiles to understand ROS production sites

  • Data analysis and interpretation:

    • Establish dose-response relationships

    • Compare kinetic parameters across experimental conditions

    • Normalize ROS production to protein amount and activity levels

    • Consider thermodynamic constraints and physiological relevance

MethodSensitivitySpecificity for ROS TypeAdvantagesLimitations
H₂DCFDAMediumLow (general ROS)Cell-permeable, easy to useAuto-oxidation, photosensitivity
MitoSOX RedHighHigh (mitochondrial O₂⁻)Mitochondria-targetedPotential artifacts with improper handling
Amplex RedVery HighHigh (H₂O₂)Extremely sensitiveExtracellular measurement only
ESR SpectroscopyMediumVery High (radical-specific)Direct radical detectionComplex instrumentation, less sensitive
LucigeninMediumMedium (O₂⁻)Real-time measurementsPotential redox cycling

How can researchers implement MT-ND4 as a molecular marker for evolutionary studies of viperid snakes?

MT-ND4 has proven valuable as a molecular marker for phylogenetic and population genetic studies in snakes. Implementing it effectively requires careful consideration of several methodological aspects:

  • Primer design and optimization:

    • Design universal primers targeting conserved flanking regions

    • Consider using degenerate bases at variable positions

    • Optimize PCR conditions for specificity and efficiency

    • Typical amplicon size: 800-1200 bp covering the most informative regions

  • Sampling strategy:

    • Include multiple individuals per population to capture intraspecific variation

    • Sample across the geographic range to detect phylogeographic patterns

    • Include representatives from multiple Bothriechis species for comparative analysis

    • Incorporate appropriate outgroups from related genera

  • Laboratory protocols:

    • Extract high-quality DNA using specialized protocols for tissue preservation

    • Use high-fidelity polymerase to minimize PCR errors

    • Implement bidirectional Sanger sequencing for accuracy

    • Consider next-generation sequencing for complex samples

  • Data analysis pipeline:

    • Quality assessment and trimming of raw sequences

    • Multiple sequence alignment with adjustment for coding regions

    • Model selection for phylogenetic analysis

    • Tree-building using Maximum Likelihood and Bayesian approaches

  • Genetic diversity indices:

    • Calculate nucleotide diversity (π) and haplotype diversity (Hd)

    • Identify informative polymorphic sites

    • Assess signatures of population expansion or contraction

    • Test for isolation by distance

  • Comparative framework:

    • Combine MT-ND4 with other mitochondrial markers (MT-CYB, D-loop)

    • Include nuclear markers for comprehensive phylogenetic analysis

    • Compare evolutionary rates across different genetic regions

    • Previous studies have successfully used MT-ND4 alongside MT-CYB for phylogenetic analysis of related species

  • Applications beyond phylogeny:

    • Species delimitation in cryptic species complexes

    • Identification of hybrids and introgression events

    • Conservation unit identification

    • Molecular dating of divergence events

  • Limitations and considerations:

    • Mitochondrial genes only track maternal lineage

    • Potential for incomplete lineage sorting

    • Need to account for rate heterogeneity across sites

    • Potential saturation at highly variable sites

What are common challenges in expressing and purifying functional recombinant MT-ND4, and how can they be addressed?

Expression and purification of functional membrane proteins like MT-ND4 present significant technical challenges. Here are common issues and their solutions:

  • Low expression levels:

    • Challenge: Hydrophobic membrane proteins often express poorly in conventional systems

    • Solutions:

      • Optimize codon usage for the expression host (E. coli has been successfully used)

      • Test different promoter strengths and induction conditions

      • Use specialized strains designed for membrane protein expression

      • Consider fusion tags that enhance solubility (MBP, SUMO, Mistic)

      • Reduce expression temperature (16-25°C) to allow proper folding

  • Protein aggregation and inclusion body formation:

    • Challenge: MT-ND4 tends to aggregate due to hydrophobic transmembrane domains

    • Solutions:

      • Express as fusion with solubility-enhancing partners

      • Add mild detergents during cell lysis (DDM, LMNG)

      • If inclusion bodies form, develop refolding protocols

      • Consider using cell-free expression systems

      • Test expression in specialized membrane-mimetic environments

  • Purification difficulties:

    • Challenge: Maintaining stability during purification

    • Solutions:

      • Use affinity tags positioned to avoid interfering with protein folding

      • Maintain detergent above critical micelle concentration throughout purification

      • Include glycerol (20-50%) in all buffers as indicated in product specifications

      • Consider on-column detergent exchange

      • Keep samples cold throughout purification

  • Low activity of purified protein:

    • Challenge: Loss of functional conformation during purification

    • Solutions:

      • Verify structural integrity using methods described in FAQ 2.2

      • Reconstitute into lipid environments mimicking mitochondrial membrane

      • Add specific lipids that interact with MT-ND4 (e.g., cardiolipin)

      • Include stability enhancers (specific metal ions, cofactors)

      • Minimize oxidative damage by including reducing agents

  • Storage stability issues:

    • Challenge: Rapid activity loss during storage

    • Solutions:

      • Store at -20°C or -80°C as recommended

      • Avoid repeated freeze-thaw cycles

      • Add cryoprotectants (glycerol at 50% final concentration)

      • Consider flash-freezing in small aliquots

      • For working stocks, limit storage at 4°C to one week

  • Quality control challenges:

    • Challenge: Verifying proper folding and function

    • Solutions:

      • Develop simplified activity assays as quality indicators

      • Use thermal shift assays to monitor stability

      • Implement rigorous purity assessment (aim for >85% as specified)

      • Consider native gel electrophoresis to assess oligomeric state

How can researchers distinguish between specific MT-ND4 effects and non-specific experimental artifacts?

Distinguishing genuine MT-ND4-specific effects from experimental artifacts requires rigorous experimental design and controls:

  • Statistical validation approach:

    • Perform sufficient biological and technical replicates (minimum n=3)

    • Apply appropriate statistical tests based on data distribution

    • Establish clear significance thresholds before experimentation

    • Consider power analysis to determine adequate sample sizes

  • Concentration-response relationships:

    • Test multiple concentrations of recombinant MT-ND4

    • True biological effects typically show dose-dependent responses

    • Non-specific effects often appear at all concentrations or only at extremes

    • Plot concentration-response curves and analyze for expected patterns

  • Controls hierarchy:

    • Vehicle controls: Buffer composition matching the recombinant protein preparation

    • Negative controls: Irrelevant proteins of similar size and properties

    • Positive controls: Well-characterized related proteins with known activities

    • Internal controls: Side-by-side comparison with established assay standards

  • Orthogonal detection methods:

    • Verify observations using multiple independent techniques

    • Example: If studying electron transfer, combine:

      • Spectrophotometric NADH oxidation measurements

      • Oxygen consumption determination

      • Membrane potential assessments

    • Consistency across methods significantly increases confidence

  • Specific inhibitor profiles:

    • Apply known inhibitors of the MT-ND4/Complex I activity

    • Compare inhibition patterns with established profiles

    • Unexpected inhibition patterns may indicate artifactual activities

  • Structural variants:

    • Generate catalytically inactive mutants through site-directed mutagenesis

    • Effects that persist with inactive mutants are likely non-specific

    • Create truncated versions lacking key domains

    • Test chimeric proteins with domains from related proteins

  • Environmental variable control:

    • Systematically test effects of:

      • pH variations

      • Temperature changes

      • Buffer composition differences

      • Presence of potential interferents

    • True MT-ND4 effects should show expected sensitivity to these variables

  • Temporal considerations:

    • Monitor time courses of observed effects

    • Enzymatic activities typically show characteristic kinetics

    • Non-specific effects may show unusual temporal patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.