Recombinant Bothriechis schlegelii Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is generated through cloning the intron-less MT-CYB gene sequence into a plasmid vector, followed by mutagenesis and biolistic transformation in microbial systems. Post-expression, the protein is purified using chromatography methods, yielding >85% purity .

Biochemical and Functional Insights

  • Role in Electron Transport: Cytochrome b is essential for transferring electrons through Complex III, contributing to ATP synthesis .

  • Structural Domains: The protein contains catalytic/binding regions critical for interactions with inhibitors like atovaquone and clomipramine .

  • Species-Specific Variations: While Bothriechis schlegelii venom is rich in toxins (e.g., metalloproteinases, PLA2), the recombinant MT-CYB focuses solely on respiratory chain functions, distinct from venom’s toxic activities .

Research Applications

  • Drug Sensitivity Studies: Mutations in homologous MT-CYB genes (e.g., m.15257G>A) alter drug responses in yeast models, suggesting utility in pharmacological research .

  • Mitochondrial Disease Models: Used to study polymorphisms linked to human disorders like male infertility (e.g., rs527236194, rs41504845) .

Limitations and Future Directions

  • Partial Sequence: The recombinant protein lacks full-length sequence data, limiting structural studies .

  • Functional Assays Needed: Further investigations into enzymatic kinetics and inhibitor binding in Bothriechis schlegelii MT-CYB are required to elucidate its unique biochemical properties.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary by purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Bothriechis schlegelii (Eyelash palm pitviper)
Target Names
Target Protein Sequence
YINYKNMSHQHMLTLFNLLPVGSNISIWWNFGSMLLACLMIQTITGFFLAIHYTANIDLA FSSIVHISRDVPCGWIMQNTXAIGASMFFICIYIHIARGIYYGSYLNKEVWLSGTTLLIT LMATAFFGYVLPWGQMSFWAATVITNLLTAIPYLGTTLTTWLWGGFAINDPTLTRFFALH FILPFIIISLSSAHILLLHNEGSNNPLGTNSDID
Uniprot No.

Target Background

Function
Recombinant *Bothriechis schlegelii* Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Bothriechis schlegelii cytochrome b and why is it important in research?

Bothriechis schlegelii cytochrome b (MT-CYB) is a mitochondrial protein found in Schlegel's palm pit viper, a venomous snake species. This protein is part of the electron transport chain's complex III and plays a critical role in energy production. Its importance in research extends to several key areas:

  • Phylogenetic studies: MT-CYB is frequently used as a molecular marker for evolutionary relationships among snake species within the Bothriechis genus and related taxa .

  • Comparative biochemistry: Studying variations in cytochrome b across different species provides insights into adaptation mechanisms and functional evolution of mitochondrial proteins .

  • Conservation biology: Genetic analysis of MT-CYB helps identify cryptic species and define conservation units within the Bothriechis genus .

  • Toxicology research: Understanding the molecular biology of venomous snakes, including their mitochondrial proteins, contributes to broader research on venom evolution and potential therapeutic applications.

What expression systems are suitable for recombinant production of snake cytochrome b proteins?

Several expression systems can be used for recombinant production of snake cytochrome b proteins, each with distinct advantages:

  • E. coli expression systems: The Rosetta-gami B(DE3) strain has proven highly effective for cytochrome b expression, addressing challenges of codon bias, disulfide bond formation, and plasmid stability . This system, when optimized with specific growth conditions and supplementation, can yield up to 26.4 mg of purified, functional cytochrome b per liter of culture .

  • Yeast expression systems: These have been used for studying cytochrome b variants, offering advantages for post-translational modifications and membrane protein expression .

  • Baculovirus-insect cell systems: While functional, these typically yield approximately 7-fold less purified cytochrome b compared to optimized bacterial systems .

  • Mammalian cell systems: These may be considered when authentic post-translational modifications are essential, though they typically offer lower yields.

For Bothriechis species proteins, bacterial systems with modified conditions show the most promising balance of yield and functionality, especially when supplemented with heme and δ-aminolevulinic acid and expressed at lower temperatures (20°C) .

What are the key considerations for designing primers for MT-CYB amplification from Bothriechis species?

When designing primers for MT-CYB amplification from Bothriechis species, researchers should consider:

  • Conserved regions: Design primers that target highly conserved regions flanking the MT-CYB gene by aligning known sequences from closely related species within Viperidae.

  • Specificity: Include species-specific variations to ensure selective amplification of Bothriechis schlegelii MT-CYB without cross-amplification of related species.

  • Complete gene coverage: For phylogenetic studies, design primers that amplify the complete MT-CYB gene (~1,140 bp). Research has shown that complete gene analysis provides more robust phylogenetic resolution within the Bothriechis genus .

  • Codon optimization: When designing synthetic genes for recombinant expression, consider optimizing codons for the host expression system while maintaining the amino acid sequence. This is particularly important when using bacterial expression systems .

  • Restriction sites: Include appropriate restriction sites for subsequent cloning while ensuring they do not exist within the target sequence.

  • PCR conditions: Utilize touchdown PCR protocols similar to those employed for other Bothriechis species, with initial denaturation at 94°C followed by annealing temperatures between 50-55°C .

What is the optimal protocol for purifying recombinant Bothriechis cytochrome b proteins?

The optimal protocol for purifying recombinant Bothriechis cytochrome b proteins involves:

  • Cell lysis and membrane preparation:

    • Harvest cells and resuspend in lysis buffer containing protease inhibitors

    • Disrupt cells through sonication or mechanical methods

    • Collect membrane fraction through differential centrifugation

  • Detergent solubilization:

    • Solubilize membrane proteins using n-dodecyl-β-D-maltoside (DM), which has been demonstrated as effective for cytochrome b proteins

    • Typical concentrations range from 1-2% DM in solubilization buffer

    • Incubate with gentle agitation for 1-2 hours at 4°C

  • Affinity chromatography:

    • Apply solubilized material to cobalt affinity resin for His-tagged proteins

    • This one-step approach can yield electrophoretically homogenous protein

    • Wash extensively to remove non-specifically bound proteins

    • Elute with imidazole gradient or step elution

  • Quality control checks:

    • Verify purity by SDS-PAGE

    • Confirm heme incorporation through spectroscopic analysis

    • Assess heme:protein ratio (ideally approaching the theoretical value of two)

    • Evaluate functional activity through ascorbate reducibility

Using this approach, researchers have achieved purification yields of 26.4 mg of functional cytochrome b per liter of bacterial culture, representing a substantial improvement over alternative expression systems .

How can researchers verify the functional integrity of purified recombinant MT-CYB proteins?

Verifying the functional integrity of purified recombinant MT-CYB proteins involves multiple complementary approaches:

  • Spectroscopic analysis:

    • Record absorption spectra in oxidized state (350-700 nm)

    • Measure spectra after reduction with ascorbate

    • Observe characteristic α and β bands (approximately 560 and 530 nm)

    • Compare spectral shifts with reference data for cytochrome b proteins

  • Heme content determination:

    • Calculate the heme:protein ratio using pyridine hemochromogen assay or spectroscopic methods

    • For cytochrome b proteins, the theoretical value is two heme groups per protein molecule

    • Values approaching this ratio indicate proper heme incorporation

  • Electron transfer activity:

    • Measure cytochrome c reductase activity using established assays

    • Monitor the rate of cytochrome c reduction spectrophotometrically

    • Calculate specific activity (nmol/min/mg protein)

  • Inhibitor sensitivity profiles:

    • Establish IC50 values for known inhibitors of cytochrome b activity

    • Compare inhibition profiles with native or reference proteins

  • Thermal stability assessment:

    • Conduct thermal denaturation studies using differential scanning calorimetry or fluorescence-based assays

    • Determine melting temperature (Tm) as an indicator of protein stability

For example, research on cytochrome b proteins has shown that functional integrity can be confirmed through ascorbate reduction kinetics, with properly folded proteins showing marked kinetic selectivity for high-potential heme centers over low-potential heme centers .

What are the key differences in phylogenetic analysis approaches for MT-CYB across Bothriechis species?

Phylogenetic analysis of MT-CYB across Bothriechis species involves several specialized approaches:

  • Multiple sequence alignment strategies:

    • Alignment via MUSCLE algorithm has proven effective for Bothriechis MT-CYB sequences

    • Protein-coding sequences should be checked for internal stop codons that might indicate pseudogenes

    • Codon-based alignments are preferred to maintain reading frame integrity

  • Partitioning schemes:

    • Appropriate partitioning is crucial for robust phylogenetic results

    • For Bothriechis studies, partitioning by gene and codon position (in protein-coding loci) has been successfully employed

    • Model selection using Bayesian Information Criterion (BIC) in programs like PartitionFinder optimizes analysis parameters

  • Analytical methods:

    • Bayesian Inference with Metropolis-Hastings coupled Markov chain Monte Carlo methods in MrBayes has been effectively used for Bothriechis phylogenies

    • Studies typically run multiple independent analyses (e.g., two runs with one cold and three heated chains) for 5 million generations

    • Sampling chains every 100 generations with the first 250,000 generations discarded as burn-in

  • Dataset considerations:

    • Mitochondrial-only datasets provide greater phylogenetic structure at inter- and intraspecific levels due to faster evolutionary rates

    • Nuclear genes (e.g., Rag-1) show less structure but can reveal deeper divergences

    • Combined mitochondrial-nuclear datasets provide the most comprehensive evolutionary picture

  • Validation approaches:

    • Stationarity of chains should be verified by plotting log-likelihood scores against generation

    • Effective Sample Size (ESS) values should exceed 500 for all parameters to ensure adequate sampling

Recent Bothriechis studies revealed that mitochondrial DNA datasets showing clear phylogenetic structure with strong support for distinct clades, while nuclear DNA phylogenies displayed less structure but still detected divergent lineages within species complexes .

How can site-directed mutagenesis of MT-CYB be utilized to investigate functional domains in snake venom evolution?

Site-directed mutagenesis of MT-CYB provides a powerful approach to investigating functional domains in snake venom evolution:

  • Target selection strategy:

    • Identify conserved vs. variable residues across Bothriechis species through comparative sequence analysis

    • Focus on residues in or near catalytic/binding domains such as Qi and Qo sites that may influence protein function

    • Select residues that differ between venomous and non-venomous species or between different venom phenotypes

  • Mutagenesis methods:

    • Utilize established protocols such as Quickchange Site-Directed Mutagenesis Kit for introducing specific mutations

    • Verify mutated sequences before expression to confirm successful mutation

    • Generate a panel of mutants targeting different functional domains

  • Functional characterization:

    • Compare enzyme kinetics between wild-type and mutant proteins

    • Assess inhibitor binding profiles to detect altered binding site properties

    • Measure electron transfer rates and specificity

  • Evolutionary context analysis:

    • Map mutations onto phylogenetic trees to correlate functional changes with evolutionary divergence

    • Assess whether mutations correlate with changes in venom composition or toxicity across species

    • Calculate selection pressures on specific residues using dN/dS ratios

For example, studies on cytochrome b variants have demonstrated that mutations in catalytic domains can significantly alter enzyme activity and drug sensitivity. The m.15257G>A (p.Asp171Asn) mutation near the Qo site increased sensitivity to atovaquone, while m.14798T>C (p.Phe18Leu) in the Qi site enhanced sensitivity to clomipramine . Similar approaches could reveal how MT-CYB variants in Bothriechis species might affect mitochondrial function and potentially relate to venom evolution.

What are the most effective approaches for comparing MT-CYB sequence variations to detect cryptic species within the Bothriechis genus?

Detecting cryptic species within the Bothriechis genus through MT-CYB sequence variations requires sophisticated analytical approaches:

  • Comprehensive sampling strategies:

    • Collect samples across the entire geographic range of target species

    • Focus on potential geographic barriers and elevation gradients

    • Include multiple individuals from each locality to capture intraspecific variation

  • Integrated genetic analysis:

    • Combine MT-CYB data with additional mitochondrial markers (16S, ND4) for comprehensive mitochondrial assessment

    • Include nuclear markers (e.g., Rag-1) to corroborate mitochondrial patterns

    • Employ multi-locus approaches to distinguish between incomplete lineage sorting and species boundaries

  • Phylogenetic methods:

    • Use both distance-based (neighbor-joining) and character-based (Bayesian, maximum likelihood) methods

    • Implement population genetic analyses such as AMOVA and FST calculations

    • Apply species delimitation algorithms (GMYC, BPP, ABGD) to objectively identify species boundaries

  • Morphological correlation:

    • Conduct Principal Component Analysis (PCA) of morphological characters to identify patterns that correspond to genetic clusters

    • Focus on diagnostic characters with high factor loadings

    • Test for morphological differences between genetically distinct lineages using multivariate statistics

Research on B. nigroviridis demonstrated the effectiveness of this approach, revealing a cryptic species (B. nubestris) through integrated analysis of MT-CYB and other genetic markers, followed by morphological confirmation through PCA of meristic scale data that explained 50.9% of total variation across the first three axes .

How do different expression systems affect the functional properties of recombinant MT-CYB proteins?

Different expression systems can significantly impact the functional properties of recombinant MT-CYB proteins in several important ways:

  • Post-translational modifications:

    • Prokaryotic systems (E. coli) lack many post-translational modification capabilities

    • Yeast systems provide intermediate modification capacity, particularly for membrane proteins

    • Insect cell systems offer more complex modifications but may differ from native snake modifications

    • The functional significance of these differences must be empirically determined for MT-CYB

  • Membrane incorporation and protein folding:

    • E. coli Rosetta-gami B(DE3) strains show improved folding for disulfide-containing proteins

    • Low-temperature induction (20°C) significantly improves proper folding and membrane incorporation

    • Supplementation with heme and δ-aminolevulinic acid ensures proper cofactor incorporation

  • Functional metrics comparison:

    • Heme:protein ratios serve as a critical quality indicator across expression systems

    • Theoretical value of two heme groups per cytochrome b molecule should be approached

    • Ascorbate reducibility confirms functional electron transfer capabilities

    • Kinetic parameters may vary between expression systems

  • Yield and purity considerations:

    • E. coli systems can yield up to 26.4 mg of purified cytochrome b per liter of culture

    • Baculovirus systems typically provide approximately 7-fold lower yields

    • Higher yields enable more comprehensive biochemical and biophysical characterization

A comparative analysis of expression systems is presented in the table below:

Expression SystemTypical Yield (mg/L)AdvantagesLimitationsHeme Incorporation
E. coli Rosetta-gami B(DE3)26.4High yield, economical, rapidLimited post-translational modificationsRequires supplementation
Yeast5-10Eukaryotic processing, membrane proteinsModerate yieldGenerally good
Baculovirus/Insect~3-4Complex modificationsLower yield, time-consumingVariable
Mammalian<1Native-like modificationsLowest yield, expensiveGenerally good

The bacterial system demonstrates substantial advantages, particularly when optimized with low-temperature induction and proper supplementation .

What methodological approaches can resolve contradictory phylogenetic signals between mitochondrial and nuclear markers in Bothriechis species?

Resolving contradictory phylogenetic signals between mitochondrial and nuclear markers in Bothriechis species requires sophisticated methodological approaches:

  • Multi-locus analysis strategies:

    • Utilize datasets with varying evolutionary rates: mitochondrial DNA for recent divergences and nuclear DNA for deeper relationships

    • Compare topologies from separate analyses of mitochondrial (e.g., MT-CYB, 16S, ND4) and nuclear markers (e.g., Rag-1)

    • Implement concatenated analysis with appropriate partitioning schemes to account for different evolutionary rates

  • Coalescent-based methods:

    • Apply species tree methods (BEAST2, *BEAST, SVDquartets) that account for incomplete lineage sorting

    • Estimate divergence times to place conflicts in temporal context

    • Use Bayesian concordance analysis to quantify support for alternative topologies

  • Addressing introgression and hybridization:

    • Implement D-statistics or similar tests to detect introgression between lineages

    • Use population genetic approaches to distinguish between incomplete lineage sorting and hybridization

    • Include additional samples from contact zones between species

  • Analytical validation approaches:

    • Conduct sensitivity analyses with varying model parameters

    • Test alternative partitioning schemes to ensure robust results

    • Implement bootstrap and posterior probability assessments to evaluate node support

In studies of Bothriechis, researchers found that mitochondrial DNA datasets showed clear phylogenetic structure with strong support for distinct clades, while nuclear DNA phylogenies displayed less structure but still detected some divergent lineages . This pattern is consistent with the faster evolutionary rate of mitochondrial markers and highlights the importance of multi-locus approaches for comprehensive phylogenetic assessment.

How can recombinant MT-CYB be used to investigate drug resistance mechanisms in snake mitochondria?

Recombinant MT-CYB provides a powerful platform for investigating drug resistance mechanisms in snake mitochondria:

  • Variant screening approach:

    • Generate a panel of MT-CYB variants based on naturally occurring polymorphisms in Bothriechis species

    • Express these variants in controlled systems such as modified E. coli or yeast

    • Systematically assess drug sensitivity profiles

  • Drug sensitivity assays:

    • Utilize inhibitor titration methods measuring cytochrome c reduction activity

    • Determine IC50 values normalized by complex III concentration

    • Apply respiratory growth assays in the presence of increasing drug concentrations

  • Structure-function analysis:

    • Map resistance-conferring mutations onto structural models

    • Focus on mutations in or near catalytic/binding domains

    • Correlate resistance patterns with specific structural changes

  • Comparative analysis across species:

    • Compare resistance profiles between Bothriechis species from different habitats

    • Investigate whether resistance correlates with environmental toxin exposure

    • Assess whether resistance mechanisms are conserved across snake lineages

Research on human MT-CYB variants has demonstrated that specific mutations can dramatically alter drug sensitivity. For example, m.15257G>A (p.Asp171Asn) increased sensitivity to atovaquone, while m.14798T>C (p.Phe18Leu) enhanced sensitivity to clomipramine . Similar approaches could reveal how MT-CYB variants in Bothriechis species might affect sensitivity to environmental toxins or therapeutic compounds.

What are the optimal approaches for integrating MT-CYB sequence data with venom proteomics for Bothriechis species?

Integrating MT-CYB sequence data with venom proteomics for Bothriechis species requires sophisticated multi-omics approaches:

  • Sample coordination strategy:

    • Collect matched samples (tissue for MT-CYB sequencing and venom) from the same individuals

    • Include representatives across the geographic range of each species

    • Consider ontogenetic variation by including specimens of different age classes

  • Molecular phylogenetics workflow:

    • Generate MT-CYB sequences using established primers and protocols

    • Construct phylogenetic trees using Bayesian and maximum likelihood methods

    • Ensure appropriate partitioning and model selection as demonstrated in Bothriechis studies

  • Venom proteomics approach:

    • Implement bottom-up proteomics with LC-MS/MS analysis

    • Quantify venom components using label-free quantification

    • Develop a protein database incorporating known Bothriechis venom proteins

  • Integrative analysis methods:

    • Map venom composition data onto MT-CYB phylogenies

    • Apply comparative methods to test for correlation between genetic distance and venom similarity

    • Use ancestral state reconstruction to infer evolutionary changes in venom composition

    • Implement phylogenetic comparative methods to detect correlated evolution

  • Functional correlation:

    • Test for associations between specific MT-CYB haplotypes and venom enzymatic activities

    • Investigate whether mitochondrial lineages correspond to differences in venom toxicity or function

    • Explore potential coevolutionary relationships between mitochondrial efficiency and venom production

This integrated approach would provide insights into how evolutionary relationships based on MT-CYB correlate with venom evolution, potentially revealing whether divergence in these systems is concordant or follows independent evolutionary trajectories.

How can comparative analysis of MT-CYB across Bothriechis species inform conservation strategies for these venomous snakes?

Comparative analysis of MT-CYB across Bothriechis species can significantly inform conservation strategies through several approaches:

  • Cryptic species identification:

    • MT-CYB analysis has proven effective in identifying previously unrecognized species, such as B. nubestris that was distinguished from B. nigroviridis

    • Conservation units should be based on accurate taxonomic assessment to ensure appropriate protection

    • Molecular diagnosis using MT-CYB can provide objective criteria for species delimitation when morphological differences are subtle

  • Genetic diversity assessment:

    • Quantify genetic diversity within and between populations using MT-CYB sequences

    • Identify evolutionarily significant units and management units

    • Prioritize protection for populations harboring unique genetic diversity

  • Phylogeographic analysis:

    • Map genetic lineages to geographic features to understand dispersal barriers

    • The "sky-island" pattern observed in Bothriechis species, where mountain ranges drive in situ divergence, has important conservation implications

    • Protect habitat corridors between isolated populations to maintain genetic connectivity

  • Historical demography insights:

    • Use MT-CYB data to infer historical population size changes

    • Identify populations that have experienced recent bottlenecks

    • Develop conservation strategies tailored to demographic history

  • Climate change vulnerability assessment:

    • Correlate MT-CYB lineage distributions with environmental parameters

    • Model potential range shifts under climate change scenarios

    • Prioritize conservation efforts for lineages with restricted elevational ranges that may be particularly vulnerable

Research on Bothriechis has demonstrated that mountain ranges, especially the Talamanca Cordillera, function as "sky-islands" driving lineage divergence . Conservation strategies must account for this fine-scale genetic structure and the specialized habitat requirements of these montane species.

What are the most effective solutions for improving recombinant MT-CYB expression when facing low yields?

When facing low yields of recombinant MT-CYB, researchers can implement several effective solutions:

  • Strain optimization:

    • Switch to specialized strains like E. coli Rosetta-gami B(DE3) that address codon bias, disulfide bond formation, and plasmid stability challenges

    • Consider strains with enhanced membrane protein expression capabilities

    • Test multiple strains in parallel to identify optimal expression systems

  • Expression condition modifications:

    • Reduce induction temperature to 20°C, which significantly improves proper folding and yield

    • Supplement growth medium with heme and δ-aminolevulinic acid to ensure proper cofactor incorporation

    • Optimize induction timing to correspond with mid-log growth phase

    • Test different inducer concentrations to find optimal expression conditions

  • Genetic construct optimization:

    • Codon-optimize the MT-CYB sequence for the expression host

    • Consider using different fusion tags beyond His-tags, such as MBP or SUMO

    • Optimize the ribosome binding site and spacing

    • Engineer out problematic secondary structures in the mRNA

  • Scale-up strategies:

    • Implement fed-batch cultivation to achieve higher cell densities

    • Optimize oxygen transfer in bioreactors for improved cellular metabolism

    • Monitor and control pH throughout the cultivation process

Through optimization of these factors, researchers have achieved yields of 26.4 mg of purified, functional cytochrome b per liter of bacterial culture, representing at least a sevenfold improvement over baculovirus expression systems .

How can researchers address challenges in phylogenetic analysis when MT-CYB sequences show incomplete lineage sorting?

Addressing incomplete lineage sorting (ILS) in MT-CYB phylogenetic analyses requires specialized approaches:

  • Multi-locus strategies:

    • Supplement MT-CYB with additional mitochondrial markers (16S, ND4)

    • Include nuclear markers (e.g., Rag-1) that evolve at different rates

    • Implement coalescent-based species tree methods that explicitly model ILS

  • Statistical testing approaches:

    • Apply the Shimodaira-Hasegawa test or Approximately Unbiased test to compare alternative topologies

    • Implement Bayesian concordance analysis to quantify topological agreement across loci

    • Use posterior predictive checks to assess model adequacy

  • Network-based visualization:

    • Construct haplotype networks rather than bifurcating trees

    • Implement statistical parsimony or median-joining networks

    • Visualize conflicting signals using consensus networks or DensiTree plots

  • Population genetic integration:

    • Calculate population genetic statistics (FST, AMOVA) to quantify population structure

    • Test for historical gene flow using isolation-with-migration models

    • Incorporate demographic history into phylogenetic interpretations

  • Simulation-based validation:

    • Conduct simulations under various demographic scenarios

    • Compare empirical patterns to simulated expectations under ILS

    • Implement posterior predictive simulation to test alternative explanations

In Bothriechis studies, researchers found that mitochondrial DNA datasets showed clear phylogenetic structure, while nuclear DNA phylogenies displayed less structure . This pattern is consistent with ILS and highlights the importance of multi-locus approaches for comprehensive phylogenetic assessment.

What strategies effectively address protein solubility and stability issues when working with recombinant snake MT-CYB?

Addressing solubility and stability challenges with recombinant snake MT-CYB requires specialized approaches:

  • Detergent optimization:

    • Screen multiple detergents for extraction efficiency and protein stability

    • n-Dodecyl-β-D-maltoside (DM) has proven effective for cytochrome b proteins

    • Optimize detergent concentration to balance extraction efficiency with protein stability

    • Consider detergent mixtures for improved solubilization

  • Buffer composition refinement:

    • Test various pH conditions to identify optimal stability range

    • Include stabilizing agents such as glycerol (10-20%)

    • Add specific lipids that may enhance membrane protein stability

    • Incorporate protein-specific stabilizers based on structural characteristics

  • Purification strategy optimization:

    • Implement rapid purification protocols to minimize time in destabilizing conditions

    • Consider on-column detergent exchange during affinity chromatography

    • Use cobalt affinity resin, which has shown success for cytochrome b purification

    • Explore detergent-free systems such as nanodiscs or amphipols for improved stability

  • Storage condition development:

    • Determine optimal protein concentration for storage (typically 1-5 mg/ml)

    • Evaluate cryoprotectants to prevent freeze-thaw damage

    • Test stability at various temperatures (4°C, -20°C, -80°C)

    • Consider flash-freezing in liquid nitrogen with subsequent storage at -80°C

  • Quality control monitoring:

    • Implement regular spectroscopic analysis to monitor heme incorporation

    • Use size-exclusion chromatography to assess aggregation state

    • Apply thermal shift assays to optimize stabilizing conditions

    • Monitor functional activity through ascorbate reducibility tests

Through optimization of solubilization and purification conditions, researchers have achieved purification yields of functional cytochrome b with retained structural integrity and enzymatic activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.