Recombinant Bothriopsis bilineata Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to Bothriopsis bilineata Cytochrome b

Bothriopsis bilineata, also known as the Two-striped forest pitviper or Bothriechis bilineatus, is a venomous snake species found in South American rainforests . While much research on this species has focused on its venom components such as phospholipases (e.g., Bbil-TX) , its mitochondrial proteins, including cytochrome b, have also been studied for both phylogenetic research and biochemical applications.

Cytochrome b (MT-CYB) is a protein encoded by the mitochondrial genome and forms a critical component of Complex III in the electron transport chain of the oxidative phosphorylation system . This system is responsible for cellular adenosine triphosphate (ATP) production, making cytochrome b essential for cellular energy metabolism . The recombinant form of this protein represents a laboratory-produced version created through genetic engineering techniques, making it available for research and commercial applications.

Molecular Properties

Recombinant Bothriopsis bilineata Cytochrome b is typically produced as a purified protein preparation used for enzymatic studies, antibody production, and other research applications. Commercial preparations are generally available in quantities of approximately 50 μg, stored in a Tris-based buffer with 50% glycerol to maintain stability .

The protein is identified in the UniProt database under accession number P92847, confirming its established recognition in protein databases . The expression region of the recombinant protein typically encompasses amino acids 1-214 of the full-length sequence .

Alternative Nomenclature

Cytochrome b from Bothriopsis bilineata is known by several alternative names in scientific literature and commercial listings, reflecting its functional role in cellular respiration:

Alternative NamesGene Designations
Complex III subunit 3MT-CYB
Complex III subunit IIICOB
Cytochrome b-c1 complex subunit 3CYTB
Ubiquinol-cytochrome-c reductase complex cytochrome b subunitMTCYB

These various designations reflect the protein's role as a component of the larger cytochrome b-c1 complex (Complex III) .

Role in Oxidative Phosphorylation

Cytochrome b plays a crucial role in the oxidative phosphorylation system, which consists of five complexes (I-V) embedded in the inner mitochondrial membrane . As the sole mitochondrially-encoded subunit of Complex III, cytochrome b catalyzes the transfer of electrons from ubiquinol to cytochrome c, a critical step in the electron transport chain that ultimately leads to ATP production .

This electron transfer activity contributes to the establishment of a proton gradient across the inner mitochondrial membrane, which drives ATP synthesis by ATP synthase (Complex V) . Disruptions in cytochrome b function can lead to significant impairments in cellular energy production, highlighting its critical role in cellular metabolism.

Phylogenetic Analysis

Cytochrome b sequences, including those from Bothriopsis bilineata, have been extensively used in phylogenetic studies of snakes and other vertebrates. The gene's relatively slow rate of evolution makes it suitable for resolving evolutionary relationships at the genus and family levels .

Researchers have used cytochrome b sequences to investigate the relationships between Bothriopsis bilineata and other pit vipers, contributing to our understanding of snake evolution and systematics . The availability of recombinant cytochrome b protein can facilitate the development of specific antibodies that may be used in immunological techniques to supplement DNA-based phylogenetic studies.

Medical Research Applications

While research on snake-derived cytochrome b is still developing, studies on human MT-CYB mutations have revealed significant implications for understanding mitochondrial diseases. Mutations in human cytochrome b can lead to conditions characterized by exercise intolerance, encephalomyopathy, cardiomyopathy, or multisystemic disorders .

Comparative studies using recombinant cytochrome b from various species, including Bothriopsis bilineata, could provide insights into the structural and functional aspects of the protein that contribute to normal and pathological states. Such research might eventually contribute to the development of treatments for mitochondrial diseases.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Bothrops bilineatus (Green jararaca) (Bothriopsis bilineata)
Target Names
Target Protein Sequence
SINYKNMPHQHLLTLLSLLPVGSNISTWWNFGSMLLACLMTQIITGFFLAIHYTANINLA FSSIIHLSRDVPCGWIMQNTHAISASLFFICIYIHIARGLYYGSYLYKEVWLSGTTLLII LMATAFFGYVLPWGQMSFWAATVITNLLTAIPYLGTTLTTWLWGGFAINDPTLTRFFALH FIFPFIIISMSSIHILLLHNEGSSNPLGTNSDIG
Uniprot No.

Target Background

Function
Cytochrome b is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c. It contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently used for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bothriopsis bilineata Cytochrome b and what are its key properties?

Recombinant Bothriopsis bilineata Cytochrome b (MT-CYB) is a protein originating from the Two-striped forest pitviper (Bothriopsis bilineata, also known as Bothriechis bilineatus). This protein is part of the cytochrome bc1 complex (Complex III) in the electron transport chain (ETC). The protein is characterized by its UniProt accession number P92847 and contains 214 amino acid residues in its expression region .

The amino acid sequence is: SINYKNMPHQHLLTLLSLLPVGSNISTWWNFGSmLLACLMTQIITGFFLAIHYTANINLAFSSIIHLSRDVPCGWIMQNTHAISASLFFICIYIHIARGLYYGSYLYKEVWLSGTTLLIILMATAFFGYVLPWGQMSFWAATVITNLLTAIPYLGTTLTTWLWGGFAINDPTLTRFFALHFIFPFIIISMSSIHILLLHNEGSSNPLGTNSDIG .

Like other cytochrome b proteins, it functions as a critical component of the respiratory chain and is commonly referred to by alternative names including Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, and Ubiquinol-cytochrome-c reductase complex cytochrome b subunit .

How does Cytochrome b function in the electron transport chain?

Cytochrome b plays a crucial role in the electron transport chain as a component of Complex III (cytochrome bc1 complex). The protein contains two discrete reaction sites involved in the Q cycle: a ubiquinone reduction center (Qi site) and a ubiquinol oxidation center (Qo site) . These sites work in tandem to facilitate electron transfer.

The functional mechanism involves:

  • Accepting ubiquinol from Complex II of the electron transport chain

  • The Qo and Qi sites acting in coordination to reduce cytochrome c through quinone-based electron bifurcation

  • Sequential oxidation of two ubiquinol molecules to ubiquinone

  • Reduction of one ubiquinone to ubiquinol

This process is essential for maintaining the proton gradient across the mitochondrial membrane that drives ATP synthesis. Inhibition of cytochrome b results in measurable decreases in oxygen consumption, as demonstrated in studies with T. cruzi epimastigotes .

What are the optimal storage conditions for Recombinant Bothriopsis bilineata Cytochrome b?

For optimal stability and functionality, Recombinant Bothriopsis bilineata Cytochrome b should be stored in a Tris-based buffer with 50% glycerol that has been optimized specifically for this protein . The recommended storage temperature is -20°C, with extended storage preferably at -20°C or -80°C to maintain protein integrity .

To prevent protein degradation through repeated freeze-thaw cycles, it is advisable to create working aliquots that can be stored at 4°C for up to one week . This approach preserves the structural and functional integrity of the protein while allowing convenient access for ongoing experimental work.

How do mutations in Cytochrome b affect its functionality and what methods are used to study them?

Mutations in cytochrome b can significantly impact its functionality, particularly when they occur at critical sites like the Qi center. Research with other organisms has demonstrated that specific mutations can confer resistance to compounds that target cytochrome b. For example, in T. cruzi, an L197F mutation in cytochrome b was identified in epimastigotes resistant to the cytochrome b inhibitor GNF7686 . Similarly, G37A and C222F mutations in L. donovani cytochrome b were associated with resistance to compound 1, which targets the Qi center .

Methods to study these mutations include:

  • Resistance generation: Exposing parasites to increasing concentrations of potential inhibitors over extended periods (70-140 days) until resistance emerges .

  • Whole genome sequencing: Identifying specific mutations in resistant clones at genome coverage between 46- and 88-fold .

  • Biochemical assays: Measuring complex III activity and oxygen consumption to assess the functional impact of mutations .

  • Structural mapping: Determining the location of mutations within the protein structure to understand their mechanistic effects .

A significant challenge in studying cytochrome b mutations is that in kinetoplastids, the gene is encoded by kinetoplast DNA (specifically maxi-circle DNA), with up to 50 copies per mitochondrial network. This makes gene editing techniques like CRISPR-Cas9 technically challenging for validation studies .

What are the comparative differences between Bothriopsis bilineata Cytochrome b and cytochrome b from other species?

The study of Bothriopsis bilineata Cytochrome b presents valuable opportunities for comparative analysis with cytochrome b proteins from other species. These comparisons can provide insights into evolutionary relationships, functional adaptations, and species-specific structural features.

Key comparative aspects to consider include:

FeatureBothriopsis bilineataOther Species (examples)Research Implications
Amino acid sequence214 amino acids with specific sequence signature Varies across species with conserved functional domainsEvolutionary analysis, structure-function relationships
Reaction site architectureContains Qi and Qo sitesSimilar architecture but with species-specific variationsTarget specificity for inhibitors, mechanism studies
Response to inhibitorsNot fully characterizedSpecies-dependent (e.g., L. donovani vs. T. cruzi show different sensitivities) Potential for selective targeting
Genetic encodingNuclear DNA (vertebrate)Kinetoplast DNA in kinetoplastids Different approaches required for genetic manipulation
Post-translational modificationsRequires investigationVaries by speciesImpact on function and stability

When designing comparative studies, researchers should consider these differences and select appropriate experimental approaches. For example, studies that successfully identified mutations in T. cruzi cytochrome b using resistance generation followed by whole genome sequencing might be adapted for studies with Bothriopsis bilineata cytochrome b .

What methodological approaches are optimal for studying inhibitor binding to the Qi site of Cytochrome b?

The Qi site of cytochrome b has been identified as a promiscuous drug target in various species, with a propensity to rapidly mutate in response to selective pressure . Understanding inhibitor binding to this site in Bothriopsis bilineata Cytochrome b requires sophisticated methodological approaches:

  • Biochemical enzyme assays:

    • Measure complex III activity using specific substrates (ubiquinol) and detection of cytochrome c reduction

    • Determine IC50 values for potential inhibitors

    • Compare with established inhibitors like antimycin A as positive controls

  • Oxygen consumption measurements:

    • Use reagents like MitoXpress Xtra to monitor real-time oxygen consumption

    • Determine IC50 values for respiratory inhibition

    • Correlate with enzymatic activity measurements

  • Resistance generation and mutation analysis:

    • Expose systems expressing the protein to sub-lethal concentrations of inhibitors

    • Gradually increase concentrations until resistance emerges

    • Sequence to identify mutations that confer resistance

  • Structural studies:

    • Use X-ray crystallography or cryo-EM to determine protein-inhibitor complexes

    • Map resistance mutations onto structures to understand binding mechanisms

    • Employ molecular docking and molecular dynamics simulations to predict binding modes

  • Comparative inhibition studies:

    • Test inhibitors across cytochrome b from different species to determine specificity

    • Examine structure-activity relationships among structurally diverse compounds that target the same site

Research has shown that structurally diverse compounds can target the Qi site, suggesting a promiscuous binding pocket. For example, compounds 1, 2, and 3 described in research with L. donovani and T. cruzi all targeted the same site despite structural differences .

How should researchers design experiments to evaluate Cytochrome b inhibitors while avoiding false positives?

Designing robust experiments to evaluate cytochrome b inhibitors requires careful consideration of several factors to minimize false positives and ensure reproducible results. Based on previous research with cytochrome b inhibitors, a comprehensive experimental design should include:

  • Multiple assay systems:

    • Primary phenotypic screening to identify potential inhibitors

    • Secondary target-based assays to confirm mechanism of action

    • Counterscreening against other potential targets to confirm specificity

  • Resistance generation protocol:

    • Begin with clonal lines of drug-susceptible organisms

    • Expose to gradually increasing concentrations of compound

    • Continue exposure for sufficient time (70-140 days based on previous studies)

    • Generate multiple resistant clones (minimum 3) for comparative analysis

    • Verify stability of resistance by culturing resistant clones without drug pressure

  • Whole genome sequencing validation:

    • Sequence at high coverage (>40-fold) to ensure detection of mutations

    • Compare across multiple resistant clones to identify consistent mutations

    • Check for other SNPs or CNVs that could indicate alternative mechanisms

  • Functional confirmation:

    • Measure complex III activity in presence of inhibitor

    • Compare inhibition of oxygen consumption in resistant vs. sensitive lines

    • Use established inhibitors (e.g., antimycin A) as positive controls

  • Cross-resistance profiling:

    • Test resistant lines against structurally diverse cytochrome b inhibitors

    • Evaluate resistance to compounds targeting other components of the ETC

    • Compare resistance profiles across different species when possible

By implementing this multi-faceted approach, researchers can minimize false positives and develop a more comprehensive understanding of compounds that interact with Bothriopsis bilineata Cytochrome b.

What are the key considerations when using Recombinant Bothriopsis bilineata Cytochrome b in comparative studies with other snake venoms?

When utilizing Recombinant Bothriopsis bilineata Cytochrome b in comparative studies with cytochrome b from other snake venoms, researchers should consider several important factors:

  • Protein preparation standardization:

    • Ensure consistent expression systems across compared proteins

    • Standardize purification protocols to achieve comparable purity

    • Verify protein folding and activity before comparison

    • Store all proteins under identical conditions (Tris-based buffer with 50% glycerol at -20°C)

  • Sequence and structural analysis:

    • Perform detailed sequence alignments to identify conserved and variable regions

    • Map variations onto 3D structural models to predict functional impacts

    • Quantify evolutionary distances between cytochrome b proteins

    • Identify species-specific post-translational modifications

  • Functional characterization:

    • Develop standardized assays for complex III activity measurement

    • Compare kinetic parameters (Km, Vmax, catalytic efficiency)

    • Evaluate inhibitor sensitivity patterns across species

    • Measure oxygen consumption under identical conditions

  • Experimental controls:

    • Include evolutionarily distant cytochrome b proteins as outgroups

    • Use well-characterized standards (e.g., mammalian cytochrome b)

    • Implement positive and negative controls in all functional assays

    • Perform technical and biological replicates to ensure reproducibility

  • Data analysis and interpretation:

    • Apply appropriate statistical methods for multi-species comparisons

    • Consider phylogenetic relationships when interpreting functional differences

    • Normalize data appropriately when comparing across species

    • Distinguish between statistically and biologically significant differences

These methodological considerations will help ensure that comparative studies yield meaningful insights into the evolutionary relationships and functional adaptations of cytochrome b across snake species.

What methods are most effective for measuring the functional activity of Recombinant Bothriopsis bilineata Cytochrome b?

Measuring the functional activity of Recombinant Bothriopsis bilineata Cytochrome b requires sensitive and specific assays that reflect its role in the electron transport chain. Based on established methods for cytochrome b assessment, the following approaches are recommended:

  • Ubiquinol-cytochrome c reductase activity assay:

    • Principle: Measures the rate of cytochrome c reduction in the presence of ubiquinol

    • Protocol:

      • Prepare reaction mixture containing buffer, reduced ubiquinol, and cytochrome c

      • Add purified cytochrome b or mitochondrial preparations

      • Monitor increase in absorbance at 550 nm over time

      • Calculate activity as nmol cytochrome c reduced per minute per mg protein

    • Advantages: Direct measure of complex III function, well-established methodology

  • Oxygen consumption measurements:

    • Principle: Quantifies respiratory activity dependent on cytochrome b function

    • Protocol:

      • Use oxygen-sensitive probes like MitoXpress Xtra reagent

      • Measure decrease in oxygen concentration over time

      • Calculate respiration rates before and after addition of potential inhibitors

      • Determine IC50 values for respiratory inhibition

    • Advantages: Reflects physiological function, can be performed with intact mitochondria

  • Binding assays with known inhibitors:

    • Principle: Measures displacement of known inhibitors by test compounds

    • Protocol:

      • Label known inhibitors (e.g., antimycin A) with fluorescent or radioactive tags

      • Measure binding to purified cytochrome b

      • Perform competition assays with unlabeled compounds

      • Calculate binding constants and inhibition parameters

    • Advantages: Provides direct evidence of binding site interactions

  • Membrane potential measurements:

    • Principle: Assesses cytochrome b contribution to membrane potential

    • Protocol:

      • Use potential-sensitive dyes like JC-1 or TMRM

      • Measure fluorescence changes in response to cytochrome b activity

      • Add inhibitors to confirm specificity

    • Advantages: Reflects integrated function within the electron transport chain

These methods should be calibrated using positive controls like antimycin A, which has demonstrated inhibitory effects on cytochrome b with IC50 values of 200 ± 36 nM for inhibition of T. cruzi respiration .

How can researchers troubleshoot expression and purification issues with Recombinant Bothriopsis bilineata Cytochrome b?

Expression and purification of membrane proteins like cytochrome b present unique challenges. Based on experience with similar proteins, the following troubleshooting approaches are recommended:

IssuePotential CausesTroubleshooting Approaches
Low expression yieldToxicity to host cells, improper codon optimizationUse specialized expression systems (e.g., C41/C43 E. coli), optimize codons for expression host, lower induction temperature, use weaker promoters
Inclusion body formationImproper folding, hydrophobic regionsAdd solubilizing agents, co-express with chaperones, use membrane-mimetic environments, express as fusion with solubility tags
Protein instabilityProtease degradation, oxidationInclude protease inhibitors, work at lower temperatures, add reducing agents, minimize freeze-thaw cycles
Poor purityNonspecific binding, incomplete washingOptimize salt concentration in buffers, use two-step purification strategy, include detergents for membrane protein solubilization
Loss of activityDenaturation during purification, cofactor lossVerify native conformation by circular dichroism, supplement with required cofactors, use milder elution conditions
Aggregation during storageImproper buffer conditionsStore in Tris-based buffer with 50% glycerol at -20°C, create small working aliquots to avoid freeze-thaw cycles

When working with Recombinant Bothriopsis bilineata Cytochrome b specifically, researchers should ensure the storage buffer is properly optimized for this protein . Additionally, it's advisable to verify protein functionality immediately after purification and to establish quality control measures that can detect batch-to-batch variations in activity.

What are the promising research avenues for studying drug resistance mechanisms involving Cytochrome b mutations?

Research on drug resistance mechanisms involving cytochrome b mutations represents a fertile area for future investigation. Based on findings with cytochrome b in other organisms, several promising research avenues emerge:

  • Comprehensive mutation mapping:

    • Systematic generation of resistance to structurally diverse inhibitors

    • Whole genome sequencing to identify resistance mutations

    • Creation of mutation frequency maps across the protein sequence

    • Correlation between mutation locations and inhibitor chemical structures

  • Predictive resistance modeling:

    • Development of computational tools to predict likely resistance mutations

    • Application of machine learning approaches to resistance prediction

    • Integration of structural and functional data to enhance predictive power

    • Validation of predictions through directed evolution experiments

  • Cross-resistance profiling:

    • Evaluation of how mutations affecting one inhibitor impact sensitivity to others

    • Development of inhibitor combinations that suppress resistance emergence

    • Identification of resistance "hot spots" vs. regions with lower mutation frequency

    • Comparison of resistance mechanisms across different species

  • Structure-guided inhibitor design:

    • Targeting regions of cytochrome b less prone to resistance mutations

    • Development of inhibitors that maintain activity against common resistance mutations

    • Design of multi-target inhibitors affecting multiple sites within the protein

    • Creation of allosteric inhibitors with novel binding modes

  • Systems biology of adaptation:

    • Investigation of compensatory mutations that restore fitness after resistance

    • Study of metabolic rewiring in response to cytochrome b inhibition

    • Analysis of alternative electron transport pathways activated during resistance

    • Examination of mitochondrial network adaptations in resistant organisms

These research directions could significantly advance our understanding of resistance mechanisms and guide the development of more robust inhibitors with reduced propensity for resistance development, addressing the identified issue of the Qi site being a promiscuous drug target with a propensity to rapidly mutate .

How might advanced structural biology techniques enhance our understanding of Bothriopsis bilineata Cytochrome b?

Advanced structural biology techniques offer unprecedented opportunities to deepen our understanding of Bothriopsis bilineata Cytochrome b's structure-function relationships. Future research utilizing these approaches could provide valuable insights:

  • Cryo-electron microscopy (Cryo-EM):

    • Determination of high-resolution structures without crystallization

    • Visualization of cytochrome b within the complete cytochrome bc1 complex

    • Capture of different conformational states during the catalytic cycle

    • Elucidation of species-specific structural features

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping of protein dynamics and conformational changes

    • Identification of regions with altered flexibility upon inhibitor binding

    • Analysis of how mutations affect protein dynamics

    • Investigation of protein-protein interaction surfaces

  • Integrative structural biology approaches:

    • Combination of X-ray crystallography, NMR, and computational modeling

    • Development of comprehensive structural models including membrane environment

    • Incorporation of molecular dynamics simulations to capture protein motion

    • Validation through cross-linking mass spectrometry and other techniques

  • Time-resolved structural studies:

    • Capturing transient states during electron transfer

    • Analysis of conformational changes during the Q cycle

    • Visualization of inhibitor binding and dissociation kinetics

    • Understanding of how mutations alter the energy landscape of the protein

  • In situ structural biology:

    • Visualization of cytochrome b within intact mitochondria

    • Correlation of structural features with functional measurements

    • Study of interactions with other respiratory complexes

    • Investigation of supercomplexes involving cytochrome bc1

These advanced approaches would provide unprecedented insights into how the unique structural features of Bothriopsis bilineata Cytochrome b contribute to its function, potentially revealing novel aspects of electron transport mechanisms and species-specific adaptations that could be exploited for research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.