Recombinant Bothrops atrox Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to Bothrops atrox and Cytochrome b

Bothrops atrox, commonly known as the common lancehead or fer-de-lance, is a venomous pit viper species widely distributed throughout the Amazon rainforest. It is considered the most medically significant snake species in South America, responsible for the majority of snakebites in the region . The species exhibits significant genetic variability, with studies based on mitochondrial DNA revealing non-monophyletic lineages that suggest complex evolutionary history . This genetic diversity has important implications for understanding the species' biology and the composition of its venom.

Cytochrome b (MT-CYB) is a critical component of the respiratory chain in mitochondria, specifically as part of complex III. In the oxidative phosphorylation system, complex III catalyzes the transfer of electrons from ubiquinol to cytochrome c, a process essential for cellular energy production . MT-CYB is uniquely encoded by the mitochondrial genome rather than nuclear DNA, making it valuable for evolutionary studies . The cytochrome b gene has been used extensively in phylogenetic studies of the Bothrops atrox species complex, providing insights into population structures and evolutionary relationships .

Protein Characteristics

Recombinant Bothrops atrox Cytochrome b is characterized as a partial protein with several alternative designations including Complex III subunit 3, Cytochrome b-c1 complex subunit 3, and Ubiquinol-cytochrome-c reductase complex cytochrome b subunit . The protein is registered in the UniProt database with the accession number P92846 . While the complete wild-type protein is embedded in the inner mitochondrial membrane, the recombinant form typically represents selected functional domains or regions of interest.

Physicochemical Properties

The recombinant MT-CYB protein from B. atrox has the following key physicochemical properties:

PropertyCharacteristic
Molecular WeightApproximately 13 kDa
Isoelectric Point (pI)Basic (likely >8.0)
Purity>85% as determined by SDS-PAGE
Stability (Liquid Form)6 months at -20°C/-80°C
Stability (Lyophilized)12 months at -20°C/-80°C

Table 1: Physicochemical properties of recombinant B. atrox MT-CYB protein

Expression Systems

Recombinant Bothrops atrox Cytochrome b can be produced using various expression systems, each with distinct advantages. The most common expression host is Escherichia coli, which provides high yields and relatively rapid production timelines . Alternative expression systems include:

  1. Yeast systems: Offer good yields and shorter turnaround times similar to E. coli

  2. Insect cells with baculovirus: Provide more complex post-translational modifications

  3. Mammalian cells: Support proper folding and retention of biological activity

For commercial production, E. coli appears to be the preferred host system as evidenced by available recombinant products . This preference likely stems from the balance between production efficiency and protein functionality suitable for most research applications.

Purification Methods

While specific purification protocols for B. atrox MT-CYB are not fully detailed in the available literature, standard protein purification techniques are likely employed. Based on protocols for similar mitochondrial proteins, the purification process may involve:

  1. Cell lysis to release the expressed protein

  2. Initial fractionation using centrifugation

  3. Affinity chromatography utilizing fusion tags (His-tag is common)

  4. Ion exchange chromatography

  5. Size exclusion chromatography for final polishing

  6. Quality control via SDS-PAGE and potentially mass spectrometry

The commercially available recombinant B. atrox MT-CYB is reported to have a purity of >85% as determined by SDS-PAGE analysis .

Native Function in Bothrops atrox

In its native context, cytochrome b functions as an integral component of the respiratory chain complex III (also known as the cytochrome bc1 complex) in the inner mitochondrial membrane of B. atrox cells. The protein plays a crucial role in the electron transport chain, facilitating the transfer of electrons from ubiquinol to cytochrome c . This process is essential for generating the proton gradient that drives ATP synthesis, the primary energy currency of cells.

The MT-CYB gene, being mitochondrially encoded, is transmitted through maternal inheritance and has a mutation rate higher than nuclear genes. This characteristic makes it valuable for evolutionary studies, including research on the phylogenetic relationships within the Bothrops atrox species complex .

Evolutionary Significance

The cytochrome b gene has been employed in multiple studies to investigate the evolutionary relationships and geographical variation patterns within the Bothrops atrox species complex. A 520 bp fragment of this gene has been analyzed to establish population phylogenies across parts of South America . These studies have helped to distinguish between morphologically similar species and to identify zones of hybridization where different Bothrops species meet.

Research using MT-CYB sequence data has revealed that B. atrox populations exhibit significant genetic variability, with evidence suggesting the existence of distinct lineages that may represent different evolutionary units . This genetic diversity may correlate with ecological adaptations and potentially with variations in venom composition, although direct links have not been firmly established.

Phylogenetic and Evolutionary Studies

Recombinant B. atrox MT-CYB and its encoding gene serve as valuable tools in phylogenetic studies. The cytochrome b gene has been extensively used to:

  1. Delineate species boundaries within the Bothrops genus

  2. Investigate geographical variation patterns

  3. Establish evolutionary relationships among populations

  4. Identify potential cryptic species or subspecies

These studies contribute to our understanding of the biogeography and evolution of venomous snakes in South America, with implications for taxonomy, conservation, and medical management of snakebites .

Antibody Production and Diagnostic Applications

Purified recombinant B. atrox MT-CYB can serve as an antigen for antibody production. Such antibodies may find applications in:

  1. Detection and quantification of B. atrox MT-CYB in biological samples

  2. Immunohistochemistry studies of mitochondrial distribution and density

  3. Development of diagnostic tools for evolutionary or taxonomic studies

Comparative Biochemistry

The availability of recombinant B. atrox MT-CYB facilitates comparative studies with homologous proteins from other species. Such comparisons can reveal:

  1. Evolutionary conservation of functional domains

  2. Species-specific adaptations in energy metabolism

  3. Potential correlations between protein structure and ecological adaptations

These comparative analyses contribute to our understanding of mitochondrial evolution and adaptation across diverse taxonomic groups.

Integration with Venomics Research

While MT-CYB is not a venom component, integrated studies combining MT-CYB phylogenetics with venom composition analyses could provide insights into the correlation between genetic diversity and venom variability in B. atrox populations. Recent peptidomic studies have already identified sex-based variations in B. atrox venom composition, particularly in disintegrin levels . Combining these approaches could help understand how evolutionary history shapes both mitochondrial genetics and venom composition.

Functional Characterization

Detailed functional characterization of recombinant B. atrox MT-CYB, including its electron transport capabilities and interactions with other components of the respiratory chain, would enhance our understanding of energy metabolism in these snakes. Such studies could potentially reveal adaptations related to the high-energy demands associated with venom production or other aspects of snake physiology.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Bothrops atrox (Barba amarilla) (Fer-de-lance)
Target Names
Target Protein Sequence
YINYKNMSHQHLLTLFNLLPVGSNISTWWNFGSMLLACLMIQIITGFFLAIHYTANINLA FSSIIHLSRDVPYGWIMQNTHAISASLFFICIYIHIARGFYYGSYLNKEVWLSGTTLLII LMATAFFGYVLPWGQMSFWAATVITNLLTAIPYLGTTLTTWLWGGFAINDPTLTRFFALH FILPFIIISMSSIHILLLHNEGSNNPLGTNSDID
Uniprot No.

Target Background

Function
Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c. MT-CYB plays a crucial role in generating a proton gradient across the mitochondrial membrane, which is subsequently used for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Bothrops atrox and why is it significant in biomedical research?

Bothrops atrox, commonly known as the Common Lancehead, is a venomous pit viper species responsible for most snakebite accidents in the Brazilian Amazon. This species has become a critical model in toxinology research due to its clinical significance and the complex composition of its venom. B. atrox envenomation typically causes local tissue damage, pain, edema, hemorrhage, and systemic effects including coagulopathy, thrombocytopenia, and potential organ failure .

The venom's rich enzymatic composition makes it valuable for studying structure-function relationships of toxins, developing improved antivenoms, and discovering novel therapeutic molecules. Research on B. atrox has identified key venom components including snake venom metalloproteinases (SVMPs), phospholipases A₂ (PLA₂s), and snake venom serine proteases (SVSPs), which collectively represent over 70% of venom proteins .

What is cytochrome b (MT-CYB) and how does it relate to Bothrops research?

Cytochrome b is a protein encoded by the mitochondrial DNA cytochrome b gene (MTCYB). While generally studied across species for its role in the respiratory chain and evolutionary analyses, MTCYB has broader research applications:

  • In clinical contexts, mutations in human MTCYB have been associated with mitochondrial myopathies, exercise intolerance, and more complex conditions like MELAS (mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes) .

  • In toxinology and herpetology, MTCYB sequences are valuable for:

    • Phylogenetic analysis and taxonomic classification of venomous snakes

    • Studying population genetics and evolutionary relationships among Bothrops species

    • Understanding mitochondrial function in venom-producing tissues

Recombinant expression of B. atrox MTCYB represents an approach to studying this protein's structure and function without requiring direct isolation from snake specimens, similar to how other B. atrox proteins have been successfully produced recombinantly .

What expression systems are most effective for recombinant snake venom proteins?

Based on successful approaches with B. atrox proteins, the following expression systems have proven effective for recombinant snake venom components:

Expression SystemAdvantagesLimitationsExample Applications
E. coliHigh yield, low cost, rapid expressionLimited post-translational modifications, inclusion body formationL-amino acid oxidase (LAAO) functional mutants
Yeast (P. pastoris)Eukaryotic processing, secretion, high yieldLonger development time, hyperglycosylationSVMPs, disintegrins, C-type lectins
Mammalian cellsNative-like processing, complex proteinsHigher cost, lower yieldMulti-domain toxins requiring mammalian folding machinery
Baculovirus/insect cellsIntermediate complexity, scalableModerate cost, viral preparationComplex enzymes requiring specific modifications

For B. atrox proteins, recombinant expression has enabled structure-function studies through mutagenesis, as exemplified by recombinant LAAO where key catalytic residues (R90, Y372, N172) were identified through systematic mutations and functional assays .

How can researchers verify functional equivalence between recombinant and native snake venom proteins?

Establishing functional equivalence between recombinant and native proteins requires comprehensive comparative analyses:

  • Biochemical characterization: Compare molecular weight, isoelectric point, and spectroscopic properties (fluorescence, circular dichroism)

  • Enzymatic activity: Measure specific activity, substrate preferences, and kinetic parameters (Km, Vmax, kcat)

    • For example, with recombinant B. atrox LAAO, researchers confirmed comparable H₂O₂ production rates to native enzyme

  • Cytotoxicity assays: Compare dose-dependent effects on relevant cell lines

    • Recombinant B. atrox LAAO demonstrated EC₅₀ values of approximately 0.8 μg/ml (14 nM) on normal keratinocytes, consistent with native LAAO

  • Structural analysis: When possible, compare crystal structures or use spectroscopic techniques to assess conformational similarity

  • Pharmacological effects: Compare physiological responses in appropriate ex vivo or in vivo models

    • For instance, comparing coagulation parameters such as clotting time, fibrinogen consumption, and platelet effects

What are the critical experimental considerations when studying recombinant B. atrox cytochrome b?

When working with recombinant B. atrox MTCYB, researchers should carefully consider:

  • Codon optimization: Bothrops protein-coding sequences often require optimization for expression hosts, particularly for membrane proteins like cytochrome b

  • Membrane integration strategies: As cytochrome b is a membrane-embedded protein, specialized approaches are needed:

    • Fusion with solubilizing tags (e.g., MBP, SUMO)

    • Membrane-mimetic systems (detergents, nanodiscs, liposomes) for functional reconstitution

    • Cell-free expression systems specifically designed for membrane proteins

  • Functional reconstitution: To assess electron transport function, researchers must:

    • Incorporate the protein into appropriate phospholipid environments

    • Provide essential cofactors

    • Establish reliable activity assays that measure electron transfer

  • Heteroplasmy considerations: When studying MTCYB mutations, researchers should account for potential heteroplasmic distributions as seen in human MTCYB mutations, where different tissues contain varying proportions of mutant and wild-type mtDNA

  • Comparative approaches: Parallel studies with MTCYB from related Bothrops species can provide evolutionary insights

How can site-directed mutagenesis elucidate structure-function relationships in B. atrox proteins?

Site-directed mutagenesis has proven highly effective for identifying functional residues in B. atrox proteins, as demonstrated with recombinant LAAO:

  • Strategic residue selection approach:

    • Target conserved residues across species (phylogenetic analysis)

    • Focus on residues in predicted active/binding sites (structural modeling)

    • Examine positively charged residues that might interact with substrates

  • Systematic mutation strategy:

    • Alanine scanning for initial identification of essential residues

    • Conservative substitutions to refine understanding of specific interactions

    • Charge reversal mutations to test electrostatic hypotheses

  • Comprehensive functional assays:

    • Catalytic activity measurements

    • Binding affinity determinations

    • Cytotoxicity assessments

    • ROS production quantification

In LAAO studies, mutations at R90, Y372, and N172 demonstrated these residues are essential for catalytic activity, while the R322 site surprisingly retained function . This approach can be adapted to study recombinant B. atrox MTCYB, focusing on residues involved in electron transport, ubiquinone binding, or protein-protein interactions.

How do geographic and ontogenetic variations in B. atrox affect recombinant protein research?

B. atrox populations exhibit remarkable variability in venom composition, which has significant implications for recombinant protein research:

  • Geographic variation: Venom protein similarities between B. atrox populations in Brazil and Colombia may be as low as 23% , necessitating careful source documentation and comparative studies

  • Ontogenetic shifts: The venom composition changes significantly as snakes mature, with different enzymatic and toxic profiles between juvenile and adult specimens

  • Habitat influence: Environmental factors influence venom composition, with distinct profiles observed across different habitat types

This variability creates several research considerations:

  • Selection of representative sequences from multiple geographic locations

  • Comparative expression and characterization of variants

  • Documentation of specimen source, age, and habitat for reproducibility

  • Potential for developing region-specific antivenoms or treatments

For recombinant MTCYB research, these factors suggest obtaining and comparing sequences from multiple populations to address potential functional or structural variations.

What advanced analytical techniques are most appropriate for characterizing recombinant B. atrox proteins?

Characterization of recombinant B. atrox proteins requires sophisticated methodologies:

Analytical TechniqueApplication to B. atrox ProteinsKey Insights
UPLC-MS/MSProtein identification, sequence verificationEnabled identification of 101 proteins in B. atrox venom
Rotational Thromboelastometry (ROTEM)Coagulation effects, dose-response relationshipsDemonstrated dose-dependent procoagulant activity of B. atrox venom
Site-directed mutagenesis with kinetic analysisStructure-function relationships, catalytic residue identificationIdentified R90, Y372, N172 as critical for LAAO activity
ROS detection assays (e.g., CellRox Green)Oxidative stress mechanisms, time-course analysisRevealed exponential H₂O₂ production (up to 10 mM in 6h) by LAAO
Cell viability assaysCytotoxicity profiling, mutant comparisonDemonstrated differential toxicity among LAAO mutants
HDX-MS (Hydrogen-deuterium exchange MS)Protein dynamics, ligand interactionsPotential technique for studying conformational changes
Cryo-EMStructural analysis of complex proteinsApplicable for multi-domain proteins or membrane complexes

For MTCYB specifically, techniques that address membrane protein challenges (e.g., nanodiscs, native MS) would be particularly valuable.

How can researchers design effective functional assays for recombinant B. atrox MTCYB?

Designing functional assays for recombinant B. atrox MTCYB requires addressing its role in electron transport:

  • Spectroscopic assays:

    • Difference spectroscopy to monitor redox changes of b-type hemes

    • EPR spectroscopy to examine paramagnetic species

    • Measurement of absorbance changes at characteristic wavelengths during electron transfer

  • Electron transfer measurements:

    • Oxygen consumption assays

    • Artificial electron acceptor/donor systems

    • Reconstitution with other respiratory complex components

  • Membrane potential assays:

    • Potentiometric dyes in reconstituted systems

    • Patch clamp techniques in whole-cell systems expressing the recombinant protein

  • Mutational analysis framework:

    • Systematic mutation of conserved residues, similar to approaches used with LAAO

    • Correlation of structural changes with functional alterations

    • Comparison with known pathogenic mutations from human MTCYB

  • In silico approaches:

    • Molecular dynamics simulations to predict effects of mutations

    • Docking studies with ubiquinone and other interaction partners

    • Sequence-structure-function relationship analyses

How might recombinant B. atrox MTCYB contribute to antivenom development?

While MTCYB itself is not a venom component, research methodologies developed for recombinant B. atrox proteins have important implications for antivenom production:

  • Recombinant venom proteins for antivenom production:

    • Overcome limited availability of native toxins

    • Enable precise antigen composition control

    • Allow immunization with consistent, well-characterized antigens

  • Comparative effectiveness testing:

    • Antivenoms can be evaluated against recombinant proteins representing regional variants

    • Current commercial antivenoms (Bothrofav™, Inoserp™ South America, Antivipmyn™ TRI, PoliVal-ICP™) show quantitative differences in neutralization capacity

    • Bothrofav™ demonstrated greater effectiveness against both B. atrox and B. lanceolatus venoms compared to other antivenoms

  • Improved treatment approaches:

    • Research shows combined therapy (antivenom plus dexamethasone) more effectively reverses inflammatory edema and promotes skeletal muscle regeneration than antivenom alone

    • Understanding protein structure-function relationships can inform development of synthetic inhibitors

What are the emerging techniques for studying Bothrops protein heterogeneity?

Advanced methods to address B. atrox protein heterogeneity include:

  • Next-generation proteomics:

    • Bottom-up proteomics without fractionation has identified 101 distinct proteins in B. atrox venom

    • UPLC separation conditions can be optimized to maximize peptide detection

    • High-resolution mass spectrometry combined with MS/MS fragmentation provides comprehensive protein identification

  • Single-cell transcriptomics:

    • Analysis of individual venom gland cells to understand cellular heterogeneity

    • Correlation of transcriptome with proteome to understand post-transcriptional regulation

  • Glycomics and glycoproteomics:

    • Characterization of glycosylation patterns in native versus recombinant proteins

    • Impact of glycosylation on immunogenicity and function

  • Comparative toxicovenomics:

    • Systematic comparison of venom composition across geographic regions

    • Correlation with clinical manifestations and treatment responses

How can computational approaches enhance recombinant B. atrox protein research?

Computational methods offer powerful tools for B. atrox protein research:

  • Homology modeling and molecular dynamics:

    • Prediction of protein structures when crystallographic data is unavailable

    • Simulation of conformational changes and ligand interactions

    • For MTCYB, modeling the membrane environment and protein-lipid interactions

  • Machine learning applications:

    • Prediction of immunogenic epitopes for antivenom development

    • Classification of toxin functions based on sequence features

    • Optimization of expression conditions based on protein properties

  • Systems biology integration:

    • Modeling of venom action as a complex biological system

    • Prediction of synergistic effects between venom components

    • Analysis of host response pathways to identify novel treatment targets

  • Phylogenetic analysis:

    • Evolutionary relationships among Bothrops species

    • Identification of conserved functional motifs

    • Prediction of functional divergence across geographic variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.