Recombinant Botryotinia fuckeliana 3-ketoacyl-CoA reductase (BC1G_11561)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BC1G_11561; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)
Target Names
BC1G_11561
Target Protein Sequence
MVLDTILPKAVLTGLAGIGAFIVAGKVISYIQLLLSLFVLSGKNLRTYGKKGTWAVVTGA
SDGLGKEYAIQLAQKGFNIVLVSRTESKLQTLASEIQTKYAGSNIQTKILAMDFAANRDE
DYAKLKALVDGLDVGILVNNVGQSHSIPVPFIQTPKEEMRDIITINCMGTLRVTQIVAPG
MVQRKRGLILTMGSFGGWLPTPLLATYSGSKAFLQQWSTSLGGELKGTGVDVELVLSYLV
TTAMSKIRRTSMFIPNPRTFVKTTLAKVGRSGGAQKMAYTSTPFWGHALMQWWLENTLGV
GGSFVVDQNKGMHQSIRTRALKKAERDAKKA
Uniprot No.
Target Background
Function
A component of the microsomal membrane-bound fatty acid elongation system, this enzyme produces very long-chain fatty acids (VLCFAs), specifically the 26-carbon variety, from palmitic acid. It catalyzes the reduction of the 3-ketoacyl-CoA intermediate in each cycle of fatty acid elongation. These VLCFAs serve as precursors for ceramide and sphingolipids.
Database Links
KEGG: bfu:BC1G_11561
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
