Recombinant Botryotinia fuckeliana Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rcf1; aim31; BC1G_15810; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)
Target Names
rcf1
Target Protein Sequence
MSNSTPLPSSFDGDTDFYEENRWQKLTRRLKEEPLIPLGCILTSLALVGASRSIRAGDHN RTQRMFRARIYAQGFTLLAMVAGSMYWDSDRKKRKEFEGVLAETKAKEKNEAWIRELEAR DEEEKEMRRARDERRRRAEGRPAPKAVVTDAPAEEGEKPKGGVMEQMSGLVWGKK
Uniprot No.

Target Background

Function
A cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.
Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Botryotinia fuckeliana and what genetic characteristics make it significant for research?

Botryotinia fuckeliana is the teleomorph (sexual stage) of Botrytis cinerea, a haploid, filamentous, heterothallic ascomycete fungus that contains a large amount of intrapopulation genetic variation. This fungus is particularly valuable for research due to its well-characterized genetic diversity and the presence of distinct sympatric populations that can be identified using molecular markers. The fungus serves as an important model for studying population genetics, reproductive strategies, and plant pathogenicity in filamentous fungi .

The significance of B. fuckeliana for research lies in its unique genetic structure, which allows researchers to investigate fundamental questions about fungal genetics, including:

  • Modes of reproduction in filamentous fungi

  • Population structure and adaptation

  • Genetic recombination mechanisms

  • Host-pathogen interactions

  • Transposable element distribution and function

How are the transposa and vacuma populations of B. fuckeliana differentiated, and what experimental approaches can identify them?

The transposa and vacuma populations of B. fuckeliana represent two unexpected sympatric populations identified in the Champagne region of France. These populations are differentiated by several key characteristics:

CharacteristicTransposa PopulationVacuma Population
Transposable elementsContains both Boty and Flipper elementsLacks both transposable elements
Geographic distributionAppears to be local and well-adaptedPresumed to be a heterogeneous migrant population
Genetic markersDistinct RFLP marker patternsDifferent RFLP marker patterns from transposa
Genetic recombinationPresentPresent

For experimental identification, researchers can use molecular techniques including:

What methodologies are most effective for studying genetic recombination in B. fuckeliana populations?

Genetic recombination in B. fuckeliana can be studied using multiple complementary approaches:

  • RFLP Marker Analysis: This technique has proven particularly valuable for detecting genetic recombination in both transposa and vacuma populations. The process involves:

    • Extracting genomic DNA from isolates

    • Digesting DNA with restriction enzymes

    • Southern blotting and hybridization with specific probes

    • Analysis of banding patterns to identify recombination events

  • Molecular Marker Development:

    • Identification of polymorphic regions within the genome

    • Development of PCR-based markers for high-throughput screening

    • Application of markers to large populations to detect recombination events

  • Population Genetic Analysis:

    • Calculation of linkage disequilibrium between markers

    • Assessment of population structure using clustering algorithms

    • Estimation of recombination rates within and between populations

When implementing these methodologies, researchers should collect isolates from diverse sources to ensure representative sampling. In the original study, no differentiation was detected between isolates from different organs, collection dates, grape varieties, or locations within the Champagne region, suggesting the need for broad sampling strategies .

How can cross-inoculation experiments be designed to study host specificity in B. fuckeliana isolates?

Cross-inoculation experiments are valuable for assessing the host range and specificity of B. fuckeliana isolates. Based on research methodologies:

  • Experimental Design Components:

    • Isolate collection from diverse host plants

    • Preparation of standardized inoculum (typically spore suspensions)

    • Wound-inoculation technique on test plants

    • Controlled environmental conditions

    • Assessment of infection development and severity

  • Recommended Procedure:

    • Obtain B. fuckeliana isolates from different vegetable hosts

    • Create artificial wounds on test plants (eggplant, pepper, tomato, bean, squash)

    • Inoculate wounds with standardized spore suspensions

    • Maintain plants under controlled temperature and humidity

    • Evaluate disease development over time

    • Assess cross-infection potential and virulence differences

  • Virulence Assessment:

    • Measure lesion diameter at regular intervals

    • Score infection severity using standardized scales

    • Calculate area under disease progress curves

    • Perform statistical analysis to determine significant differences in virulence

In previous research, this approach allowed identification of the most virulent isolate (PF.10) through systematic cross-inoculation experiments .

What is the relationship between Aim31 and mitochondrial DNA inheritance, and how was this discovered?

Aim31 (later renamed Rcf1) was originally identified in a screen designed to discover genes encoding proteins whose absence caused an altered inheritance of mitochondrial DNA (mtDNA). This connection was established through systematic screening approaches that identified the AIM (Altered Inheritance of Mitochondria) gene family .

The relationship between Aim31 and mtDNA inheritance involves:

  • Discovery Process:

    • Systematic genetic screening for mutants with altered mtDNA inheritance patterns

    • Identification of Aim31 as a member of the AIM gene family

    • Subsequent characterization revealing Aim31's association with respiratory complexes

  • Functional Implications:

    • Aim31/Rcf1 plays a critical role in mitochondrial respiratory function

    • The protein associates with cytochrome bc1-cytochrome c oxidase (COX) supercomplex

    • This association suggests a mechanistic link between respiratory complex assembly and mtDNA maintenance

  • Current Understanding:

    • Aim31/Rcf1 is now recognized as a member of the conserved hypoxia-induced gene 1 (Hig1) protein family

    • Its role extends beyond mtDNA inheritance to include respiratory supercomplex assembly and regulation

    • The mechanism connecting respiratory complex assembly with mtDNA inheritance remains an active area of research

How does Aim31/Rcf1 interact with the cytochrome bc1-COX supercomplex at the molecular level?

Aim31/Rcf1 interacts with the cytochrome bc1-COX supercomplex in a specific and functionally significant manner:

  • Physical Association:

    • Rcf1 comigrates with the cytochrome bc1-COX supercomplex on native gels (BN-PAGE)

    • Affinity purification using His-tagged cytochrome c1 and Aac2 derivatives confirms this physical association

    • Rcf1 partitions primarily with the COX complex portion of the supercomplex

  • Protein-Protein Interactions:

    • Rcf1 directly interacts with the Cox3 subunit of the COX complex

    • This interaction can occur prior to their assembly into the COX complex

    • Rcf1 may function as a bridge between the COX complex and the cytochrome bc1 complex

    • A close proximity between Rcf1 and members of the ADP/ATP carrier (AAC) family has been established

  • Functional Significance:

    • Rcf1's association with the supercomplex is required for optimal COX enzyme activity

    • The protein appears to regulate COX complex function through its interaction with Cox3

    • This regulation may be influenced by neighboring AAC proteins

    • No previous assembly partner for Cox3 had been identified in either bacterial or mitochondrial systems before Rcf1

Interaction PartnerNature of InteractionFunctional Significance
Cox3Direct protein-protein interactionRegulation of COX activity
Cytochrome bc1 complexBridge-like associationSupercomplex assembly/stability
AAC proteinsClose proximityPossible communication between OXPHOS activity and ATP/ADP levels

What is the relationship between Rcf1 and Rcf2 in mitochondrial respiration, and how can researchers investigate their functional overlap?

Rcf1 (formerly Aim31) and Rcf2 (formerly Aim38) display overlapping functions in mitochondrial respiration, with their joint presence required for optimal cytochrome c oxidase (COX) enzyme activity. To investigate this functional relationship:

  • Experimental Approaches to Study Rcf1-Rcf2 Relationship:

    • Generate single and double deletion mutants (Δrcf1, Δrcf2, and Δrcf1Δrcf2)

    • Measure COX enzyme activity in each mutant background

    • Analyze supercomplex assembly using Blue Native PAGE (BN-PAGE)

    • Perform protein interaction studies using affinity purification

    • Conduct genetic complementation experiments

  • Key Findings on Functional Overlap:

    • Rcf1 and Rcf2 can independently associate with the cytochrome bc1-COX supercomplex

    • Their joint presence is required for optimal COX enzyme activity

    • Loss of both proteins (but not individual loss) significantly impacts COX enzyme activity

    • Double deletion affects assembly of peripheral COX subunits Cox12 and Cox13

    • This suggests at least two forms of the supercomplex exist within mitochondria

  • Mechanistic Model:

    • Rcf1 and Rcf2 may act as bridges supporting supercomplex assembly

    • They appear to regulate COX enzyme activity through Cox3 and associated Cox12 protein

    • This regulation may be influenced by neighboring AAC proteins

    • Both proteins belong to the hypoxia-induced gene 1 (Hig1) family, with Rcf2 showing limited similarity to Hig1 proteins

What experimental techniques are most effective for studying the assembly and regulation of respiratory supercomplexes?

Investigation of respiratory supercomplex assembly and regulation requires specialized techniques:

  • Protein Complex Isolation and Analysis:

    • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): Enables separation of intact protein complexes

    • Affinity purification using histidine-tagged proteins: Allows isolation of specific complexes

    • Mild detergent solubilization (e.g., digitonin): Maintains supercomplex integrity during isolation

    • Mass spectrometry: Identifies components of isolated complexes

  • Functional Analysis:

    • Spectrophotometric enzyme activity assays: Quantify COX and cytochrome bc1 complex activities

    • Oxygen consumption measurements: Assess respiratory function

    • Membrane potential assays: Evaluate consequences of supercomplex disruption

  • Protein-Protein Interaction Studies:

    • Chemical crosslinking: Captures transient or weak interactions

    • Co-immunoprecipitation: Confirms protein associations

    • Proximity labeling techniques: Identifies proteins in close spatial relationship

    • Structural analysis (cryo-EM): Resolves architectural details of supercomplexes

  • Genetic Approaches:

    • Deletion mutants: Assess consequences of specific protein loss

    • Site-directed mutagenesis: Identifies critical residues for interactions

    • Suppressor screens: Reveals genetic interactions and functional relationships

These methodologies were successfully employed to discover Rcf1 as a novel component of the cytochrome bc1-COX supercomplex and characterize its interactions with Cox3 and other components .

What potential exists for studying Hig1 family proteins in fungal plant pathogens like B. fuckeliana?

The study of Hig1 family proteins (like Rcf1/Aim31) in fungal plant pathogens such as B. fuckeliana represents an unexplored frontier with significant potential:

  • Research Opportunities:

    • Identification of Hig1 homologs in B. fuckeliana genome

    • Characterization of their role in mitochondrial function

    • Investigation of potential connections to pathogenicity

    • Analysis of expression patterns under infection conditions and hypoxic stress

  • Methodological Approaches:

    • Comparative genomics to identify Hig1 family members across fungal species

    • Gene deletion/silencing to assess function in pathogenicity

    • Protein localization studies to confirm mitochondrial association

    • Expression analysis under various environmental conditions and during plant infection

  • Potential Significance:

    • Mitochondrial function is critical for fungal virulence and stress adaptation

    • Hypoxic conditions can occur during plant infection

    • Hig1 proteins respond to hypoxia and regulate respiratory function

    • Understanding these connections could reveal new targets for disease control

While the search results don't directly establish Hig1 protein function in B. fuckeliana, the conservation of this protein family across species suggests potential functional importance in this fungal plant pathogen .

How might understanding mitochondrial protein function contribute to biological control strategies against B. fuckeliana?

Mitochondrial proteins represent potential targets for novel biological control strategies against B. fuckeliana (Botrytis cinerea):

  • Conceptual Framework:

    • Mitochondrial proteins often have essential functions in energy metabolism

    • Disruption of these proteins could impair fungal growth and virulence

    • Species-specific differences in mitochondrial proteins could allow targeted control

    • Understanding mitochondrial function may reveal metabolic vulnerabilities

  • Research Approaches:

    • Screening biocontrol agents for effects on mitochondrial function

    • Testing antagonistic microorganisms for production of compounds targeting mitochondria

    • Developing assays to measure mitochondrial activity during biocontrol interactions

    • Investigating mitochondrial protein expression during antagonistic interactions

  • Practical Applications:

    • The antagonistic microorganisms identified in previous research (Trichoderma viride, Bacillus subtilis, and Actinomycetes) could potentially target mitochondrial functions

    • These biocontrol agents showed varying degrees of effectiveness against B. fuckeliana in greenhouse experiments

    • Understanding their mechanisms of action could lead to optimization of biocontrol strategies

    • Potential for developing synthetic compounds that mimic natural inhibitors of fungal mitochondrial proteins

Biocontrol AgentPreventive EffectApplication MethodPotential Mitochondrial Target
Trichoderma viride (AF.1)24-29%Spore suspension (10^7-10^8 spore/ml)Respiratory chain components
Bacillus subtilis (AB.27/59)Not effective in greenhouseCell suspension (5x10^4-10^9 cell/ml)ATP synthesis pathway
Actinomycete isolate (AA.11/98)10%Spore suspensionElectron transport proteins

By connecting research on mitochondrial protein function with biocontrol development, more effective and targeted strategies against B. fuckeliana could emerge .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.