Recombinant Botryotinia fuckeliana Assembly factor cbp4 (cbp4)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cbp4; BC1G_09937; Assembly factor cbp4; Cytochrome b mRNA-processing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)
Target Names
cbp4
Target Protein Sequence
MPPKPTNWRMYGKMAVAGLTCCVGGPALIYYISPTEEELFLKYNPELQKRSLENRVGKQE
DFDNFVARLKEYSKSDRPIWVEAEEAARKKRSGKIEEQAKLMQEMQQRKEEIKKSGTNLM
PGGSL
Uniprot No.
Target Background
Function
Essential for the assembly of ubiquinol-cytochrome c reductase. It directly influences the proper incorporation of the Rieske protein, core 4, core 5, and apocytochrome b.
Database Links
KEGG: bfu:BC1G_09937
Protein Families
CBP4 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
