Recombinant Botryotinia fuckeliana Golgi apparatus membrane protein tvp18 (tvp18)

Shipped with Ice Packs
In Stock

Description

3.1. Localization and Interactions

  • Golgi Subcompartments: TVP18 localizes to Tlg2-containing late Golgi/endosomal compartments .

  • Protein Network: Interacts with Yip1-family proteins (Yip4, Yip5) in yeast, implicating roles in membrane trafficking and compartmentalization .

3.2. Functional Implications

  • Vesicular Transport: Disruption in yeast (Δtvp15/Δtvp23) exacerbates defects in ypt6 or ric1 mutants, critical for vesicle fusion and sorting .

  • Pathogenicity: In Botrytis cinerea, Golgi-associated proteins regulate toxin production (e.g., botrydial) and host invasion .

Genomic Context and Evolutionary Conservation

TVP18 is encoded by BC1G_03398 in Botryotinia fuckeliana (strain B05.10), a strain with a sequenced genome of ~42.9 Mb . The gene is part of a core chromosome, reflecting its conserved role across fungi.

Genomic FeatureDetail
ChromosomeCore chromosome (BCIN1–BCIN16)
Gene DensityHigh, with ~11,701 protein-coding genes in B. cinerea
OrthologsFound in Lodderomyces elongisporus (A5DSM9), Sclerotinia sclerotiorum (A7EMV1) .

Applications and Research Utility

TVP18 serves as a critical reagent in fungal pathogen studies:

5.1. Research Applications

  • ELISA Kits: Used to detect TVP18 antibodies or quantify protein levels in Botrytis infections .

  • Structural Analysis: His-tagged versions enable purification for X-ray crystallography or cryo-EM .

  • Functional Assays: Studies on trafficking defects in Δtvp18 mutants could elucidate virulence mechanisms .

5.2. Industrial Potential

  • Biotechnology: Serves as a model for membrane protein engineering in fungal pathogens .

  • Diagnostic Tools: Potential in detecting Botrytis infections via antibody-based assays .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tvp18; BC1G_03398; Golgi apparatus membrane protein tvp18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)
Target Names
tvp18
Target Protein Sequence
MTIAEEFATRNFSYGQWTGVVCILLCFALGIANLFHVSLLIIFSALCLVSSFLIIFIEIP LLLRICPTSSTFDTFMRRFTTNYMRAAIYMGMAIVQWLSIIIDASSLIAAAVLLTIAAGF YALAGLKGQGFVGSKTLGGQGVAQMIL
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP18 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Botryotinia fuckeliana and its relationship to Botrytis cinerea?

Botryotinia fuckeliana is the teleomorph (sexual stage) of Botrytis cinerea, a haploid, filamentous, heterothallic ascomycete fungus . This pathogen is the causal agent of "grey mould" disease, affecting at least 1400 plant species, including crops of economic importance such as grapes and strawberries . Although the scientific community decided during the XVI International Symposium in 2013 to primarily use the name Botrytis for this genus, both morphic stages continue to be referenced in scientific literature .

The life cycle of B. fuckeliana consists of both sexual and asexual reproductive phases. The sexual process in B. fuckeliana is controlled by a single mating type gene with two alleles (MAT1-1 and MAT1-2), confirming its heterothallic nature with only two mating types . This genetic understanding is crucial for researchers working with recombinant proteins from this organism.

How does the genetic diversity of Botryotinia fuckeliana influence protein expression studies?

Botryotinia fuckeliana exhibits substantial genetic diversity, with studies demonstrating significant intrapopulation genetic variation . Two sympatric populations were identified in the Champagne region of France: transposa (containing transposable elements Boty and Flipper) and vacuma (lacking these elements). These populations differed across all other genetic markers tested .

This genetic diversity has critical implications for protein expression studies:

  • Strain selection is crucial - different isolates may express varied protein isoforms

  • Post-translational modifications may differ between strains

  • Expression levels of tvp18 and other membrane proteins may vary among populations

  • Genetic recombination, confirmed by RFLP markers in both populations, contributes to heterogeneity

Researchers must carefully document strain information and consider the impact of genetic diversity when designing expression systems for recombinant proteins from this organism.

What are the optimal conditions for expressing recombinant tvp18 protein from Botryotinia fuckeliana?

For optimal expression of recombinant tvp18, researchers should consider:

Expression System Selection:

  • Heterologous expression in E. coli systems may be challenging due to tvp18's multiple transmembrane domains

  • Yeast expression systems (P. pastoris or S. cerevisiae) often yield better results for eukaryotic membrane proteins

  • Filamentous fungi expression systems (e.g., Aspergillus or Neurospora) may provide more appropriate post-translational modifications

Optimization Parameters:

  • Temperature: Lower temperatures (16-20°C) typically improve membrane protein folding

  • Induction conditions: Gradual induction using titrated concentrations of inducer

  • Buffer composition: Tris-based buffer with 50% glycerol has been documented for stabilization

  • Fusion tags: Consider solubility-enhancing tags (MBP, SUMO) or purification tags (His, GST)

Storage Considerations:

  • Store at -20°C for short-term or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

How can researchers optimize purification protocols for recombinant tvp18?

Purification of membrane proteins like tvp18 requires specialized approaches:

Extraction Optimization:

  • Detergent screening is critical - test a panel including:

    • Non-ionic detergents (DDM, Triton X-100)

    • Zwitterionic detergents (LDAO, CHAPS)

    • Newly developed amphipols or nanodiscs for stability

Purification Strategy:

  • Initial capture: Affinity chromatography utilizing fusion tags

  • Intermediate purification: Ion exchange chromatography

  • Polishing step: Size exclusion chromatography

Quality Control Metrics:

  • SDS-PAGE with western blot confirmation

  • Circular dichroism to assess secondary structure

  • Dynamic light scattering for homogeneity assessment

  • Thermal shift assays to evaluate stability in different buffer conditions

The chosen purification protocol should be validated through activity assays relevant to the hypothesized function of tvp18 in Golgi trafficking or membrane organization.

What approaches can be used to study protein-protein interactions involving tvp18?

To investigate protein-protein interactions involving tvp18, researchers can employ several complementary techniques:

In vitro Approaches:

  • Pull-down assays using recombinant tvp18 as bait

  • Surface Plasmon Resonance (SPR) for direct binding kinetics

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • Crosslinking mass spectrometry to capture transient interactions

In vivo Approaches:

  • Yeast two-hybrid screening (consider membrane-based variants)

  • Bimolecular Fluorescence Complementation (BiFC)

  • Förster Resonance Energy Transfer (FRET)

  • Proximity-dependent biotin identification (BioID)

Analysis of the B. fuckeliana Surfactome:
Recent proteomic studies have characterized the surfactome (surface proteins) of B. cinerea, identifying 1010 proteins that may interact at the cell surface . Cross-referencing tvp18 with this surfactome dataset could reveal potential interaction partners, particularly those involved in pathogenicity mechanisms.

How might tvp18 contribute to virulence and pathogenicity mechanisms in Botryotinia fuckeliana?

The pathogenicity of B. fuckeliana involves complex mechanisms, and membrane proteins like tvp18 may play significant roles:

Potential Functions in Virulence:

  • Secretory pathway regulation - tvp18 as a Golgi membrane protein may facilitate trafficking of virulence factors

  • Hypersensitive response modulation - possibly interfacing with proteins like Hip1, which triggers noncanonical PTI to induce plant cell death

  • Stress response during host colonization - membrane proteins often participate in environmental sensing

  • Cell wall integrity maintenance during invasion - proper Golgi function is essential for cell wall component delivery

Evidence from Related Systems:
The surfactome (surface proteins) of B. cinerea has been analyzed through proteomics approaches, revealing 1010 identified proteins that represent front-line receptors mediating dialogue between the fungus, plant, and environment . While tvp18 is a Golgi protein, it may influence the composition and function of these surface proteins through trafficking regulation.

To experimentally determine tvp18's role in pathogenicity:

  • Generate knockout mutants using CRISPR/Cas9

  • Evaluate virulence on different host plants

  • Perform comparative proteomics of secreted factors

  • Analyze interaction with plant defense systems

What is the evolutionary conservation of tvp18 across fungal species and what does this suggest about its function?

Evolutionary analysis of tvp18 can provide insights into its functional importance:

Comparative Analysis Framework:

  • Conduct phylogenetic analysis of tvp18 homologs across:

    • Close relatives within Sclerotiniaceae family

    • Broader ascomycete fungi

    • Distantly related fungal lineages

  • Identify conserved domains and motifs:

    • Transmembrane domains

    • Sorting signals

    • Post-translational modification sites

Functional Implications:
High conservation would suggest fundamental roles in cellular processes, while diversification may indicate adaptation to specific ecological niches or host interactions.

Research Approach:

  • BLAST searches against fungal genomes

  • Multiple sequence alignment of homologs

  • Detection of selection signatures (dN/dS ratios)

  • Structural modeling to identify conserved features

  • Complementation studies in distantly related fungi

This evolutionary perspective can guide hypothesis formulation about tvp18's essential functions versus its specialized adaptations in B. fuckeliana.

How can systems biology approaches integrate tvp18 into the broader cellular networks of Botryotinia fuckeliana?

Systems biology offers powerful frameworks to contextualize tvp18 within cellular processes:

Multi-omics Integration Strategy:

  • Transcriptomics: Analyze tvp18 expression patterns across:

    • Different life cycle stages

    • Infection phases

    • Environmental stresses

    • Sexual vs. asexual reproduction conditions

  • Proteomics: Identify co-regulated proteins and potential interaction partners

    • Leverage existing surfactome data (1010 identified proteins)

    • Compare with secretome analyses

  • Metabolomics: Examine changes in:

    • Secondary metabolite production (botrydial, botcinic acid)

    • Membrane lipid composition

    • Signaling molecules

Network Modeling Approaches:

  • Construct protein-protein interaction networks

  • Develop gene regulatory networks incorporating tvp18

  • Apply pathway enrichment analysis to identify processes affected by tvp18 perturbation

Experimental Validation:

  • Time-series experiments capturing dynamic changes

  • Perturbation studies (gene silencing, overexpression)

  • Localization studies during key cellular events

This systems approach would reveal how tvp18 functions within the broader context of B. fuckeliana biology, potentially identifying unexpected connections to pathogenicity, development, or stress responses.

What are the major challenges in producing sufficient quantities of functional recombinant tvp18 for structural studies?

Membrane proteins like tvp18 present significant challenges for structural biology:

Common Challenges:

ChallengeTechnical ImpactPotential Solutions
Low expression levelsInsufficient material for structural studiesCodon optimization; Use strong inducible promoters; Screening multiple expression hosts
Protein misfoldingNon-functional protein; AggregationExpression at lower temperatures (16-20°C); Addition of chemical chaperones; Co-expression with chaperone proteins
Detergent selectionProtein instability; Loss of native conformationSystematic detergent screening; Use of novel amphipathic polymers; Lipid nanodisc incorporation
Protein heterogeneityDifficult crystallization; Poor NMR spectraLimited proteolysis to remove flexible regions; Engineering of thermostabilizing mutations; Monodispersity verification by SEC-MALS
Post-translational modificationsNon-native protein productionExpression in eukaryotic systems; Glyco-engineering approaches

Advanced Solutions:

  • Cell-free expression systems for direct incorporation into nanodiscs

  • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL)

  • Antibody fragment co-crystallization to stabilize flexible regions

  • Lipidic cubic phase crystallization specifically designed for membrane proteins

How can genetic manipulation techniques be applied to study tvp18 function in Botryotinia fuckeliana?

Modern genetic tools offer powerful approaches to investigate tvp18 function:

Gene Deletion/Knockout:

  • CRISPR/Cas9 system adapted for B. fuckeliana

    • Design specific sgRNAs targeting tvp18

    • Screen transformants using PCR and sequencing

    • Validate by RT-qPCR and western blotting

  • Homologous recombination-based approaches

    • Generate deletion cassettes with appropriate selectable markers

    • Target the BC1G_03398 locus (tvp18 ORF)

Conditional Expression Systems:

  • Inducible promoters responsive to:

    • Tetracycline or doxycycline

    • Methanol or ethanol

    • Nitrogen source switching

    • Temperature shifts

Protein Tagging Strategies:

  • C-terminal vs. N-terminal tags (considering membrane topology)

  • Fluorescent protein fusions for localization studies

  • Epitope tags for immunoprecipitation

  • Proximity labeling tags for interaction studies

Expression Modulation:

  • RNA interference (RNAi) for gene silencing

  • Overexpression under constitutive promoters

  • Promoter replacement for altered expression timing

Success in these genetic manipulations requires consideration of the mating system and genetic recombination capabilities of B. fuckeliana, leveraging the detailed understanding of its sexual reproduction mechanisms .

What analytical methods are most effective for characterizing the membrane topology and post-translational modifications of tvp18?

Comprehensive characterization of tvp18 requires specialized analytical approaches:

Membrane Topology Determination:

  • Protease protection assays:

    • Limited proteolysis of intact vs. permeabilized membranes

    • Mass spectrometry identification of protected fragments

  • Substituted cysteine accessibility method (SCAM):

    • Introduction of cysteine residues at predicted transmembrane boundaries

    • Selective labeling with membrane-permeable vs. impermeable reagents

  • Fluorescence techniques:

    • Environment-sensitive fluorescent probes

    • Fluorescence quenching experiments

Post-translational Modification Analysis:

  • Mass spectrometry workflows:

    • Enrichment strategies for modified peptides

    • Multiple fragmentation techniques (CID, ETD, HCD)

    • Glycopeptide analysis using specialized software

  • Site-directed mutagenesis:

    • Mutation of predicted modification sites

    • Functional analysis of mutants

  • Specific detection methods:

    • Anti-phosphotyrosine antibodies

    • Glycan-specific lectins

    • Metabolic labeling with modified precursors

Data Integration:
Combining experimental data with computational predictions (from tools like TMHMM, SignalP, NetNGlyc) provides a comprehensive model of tvp18 topology and modifications, essential for understanding its functional mechanisms in the Golgi apparatus.

How might tvp18 interact with plant host systems during Botryotinia fuckeliana infection?

The interaction between fungal proteins and plant hosts represents a frontier in understanding pathogenicity:

Potential Host Interaction Mechanisms:

  • Direct interaction with plant receptors

    • Could tvp18 influence the delivery of effectors like Hip1, which is known to trigger noncanonical plant defense responses ?

    • Might Golgi trafficking regulated by tvp18 impact the secretion of virulence factors?

  • Modulation of plant defense signaling

    • Potential indirect effects on plant cell death pathways

    • Influence on host protein trafficking or secretion

Experimental Approaches:

  • Yeast expression system displaying tvp18 challenged with plant extracts

  • Co-immunoprecipitation studies using plant-fungal interface samples

  • Transcriptomic analysis of plant responses to wild-type vs. tvp18 mutant strains

  • Live-cell imaging of labeled tvp18 during host invasion

Given that B. fuckeliana secretes large amounts of phytotoxic proteins and cell wall-degrading enzymes , understanding how Golgi proteins like tvp18 contribute to this secretion process could reveal new targets for disease control.

What role might tvp18 play in fungicide resistance mechanisms in Botryotinia fuckeliana?

Fungicide resistance is a critical concern for controlling B. fuckeliana infections:

Potential Mechanisms Involving tvp18:

  • Altered drug trafficking or compartmentalization

    • As a Golgi membrane protein, tvp18 might influence intracellular distribution of fungicides

    • Mutations could affect membrane permeability or transport protein localization

  • Stress response coordination

    • Membrane proteins often participate in cellular stress responses

    • tvp18 might indirectly regulate expression of resistance genes

Research Directions:

  • Comparative expression analysis of tvp18 in sensitive vs. resistant strains

  • Microscopy studies of fungicide localization in wild-type vs. tvp18 mutants

  • Investigation of genetic linkage between tvp18 polymorphisms and resistance phenotypes

  • Proteomics analysis of membrane composition changes during fungicide exposure

Previous genetic studies have demonstrated independent segregation of resistance to different fungicides in B. fuckeliana , suggesting complex mechanisms that might involve membrane trafficking proteins like tvp18.

How could advanced structural biology techniques be applied to understand tvp18 function in detail?

Recent advances in structural biology offer unprecedented opportunities:

Cutting-Edge Methodologies:

TechniqueApplication to tvp18Expected Insights
Cryo-electron microscopySingle-particle analysis of purified tvp18High-resolution structure; Conformational states
Integrative structural biologyCombining X-ray crystallography, NMR, and computational modelingComplete structural model incorporating flexible regions
Hydrogen-deuterium exchange mass spectrometryAnalysis of tvp18 dynamics and interactionsConformational changes upon binding; Solvent-accessible regions
Solid-state NMRAnalysis in membrane-mimetic environmentsNative-like structural information; Lipid interactions
AlphaFold2 and other AI-based predictionIn silico modeling based on sequenceStarting models for experimental validation; Structure-guided mutagenesis

Functional Structure Studies:

  • Structure-guided mutagenesis to probe:

    • Trafficking motifs

    • Protein-protein interaction interfaces

    • Membrane integration regions

  • Small molecule screening against structural pockets

    • Potential for specific inhibitors

    • Chemical biology approaches to tvp18 function

These structural studies would significantly advance our understanding of how tvp18 contributes to Golgi function in B. fuckeliana and might reveal unique features that could be exploited for targeted antifungal development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.