Recombinant Botryotinia fuckeliana Golgi apparatus membrane protein tvp38 (tvp38)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Tvp38 is produced through heterologous expression systems, typically in E. coli, with a His-tag for purification . Key specifications include:

ParameterDetails
Source OrganismBotryotinia fuckeliana
Expression HostEscherichia coli
Protein LengthFull-length (exact length unspecified; homologs span ~300-400 residues)
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder at -20°C/-80°C; Tris/PBS buffer with trehalose
ReconstitutionSterile water or glycerol-containing buffers

Research Findings in Fungal Pathogens

Studies on homologous proteins in Botrytis cinerea (anamorph of B. fuckeliana) reveal:

  • Gene deletion mutants (ΔBcest):

    • Reduced conidial germination and hyphal elongation .

    • Impaired necrotic colonization of host tissues (e.g., grapevine leaves) .

    • Downregulation of virulence-associated genes during infection .

  • Role in membrane integrity: Tvp38 homologs maintain Golgi and thylakoid membrane architecture in fungi and plants .

Limitations and Future Directions

  • Structural ambiguity: The exact tertiary structure and substrate-binding mechanism remain unresolved .

  • Species-specific variations: Functional insights are extrapolated from yeast (Saccharomyces cerevisiae) and bacterial homologs .

  • Therapeutic potential: No direct evidence links Tvp38 inhibition to antifungal efficacy in vivo.

References

  1. Recombinant Kluyveromyces lactis Tvp38 specifications .

  2. Functional analysis of Botrytis cinerea Bcest .

  3. Structural and evolutionary insights into Tvp38/DedA proteins .

  4. Commercial recombinant B. fuckeliana Tvp38 product details .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
tvp38; BC1G_00190; Golgi apparatus membrane protein tvp38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)
Target Names
tvp38
Target Protein Sequence
MPADYSSTARALALPISPLETPSSPDQHVERPPWSRRISSNVRRANNSASPYSNQPTTSF KDQILRKAEKLQRKFVSTWQKLSPLQKCLAVGAAVLNIILIALFLVYQHQIFASLAPFAE RWRDMRGGWMILWAMTFVAAFPPLIGYSSTITIAGFVYGVPKGWAIVASATVAGSLCSFL ASRTILSSYVHRLVGKDKRFEALALTLKHDGIKILCMIRLCPLPYSLSNAAVATFPTVHP LNYALATALVTPKLFIHVFIGSRLGSLAGDEEMDASTKLINYASIIIGAGLGATVGYVIY QRTMARAKELEIEELEAANGDVAAGRRVAAEYSDANNDDAALMNDDDISLWDNEDAQTGY TDFVDEDEADVFASGDLDEEGNIGGKGKTAGT
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking and spindle migration.
Database Links
Protein Families
TVP38/TMEM64 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Botryotinia fuckeliana tvp38 and what is its cellular localization?

Botryotinia fuckeliana Golgi apparatus membrane protein tvp38 (UniProt ID: A6RIB9) is a transmembrane protein primarily localized in the Golgi membrane system. This protein is found in Botryotinia fuckeliana, also known as Botrytis cinerea or Noble rot fungus . The protein was originally identified through proteomic analysis of Tlg2-containing membrane compartments in Saccharomyces cerevisiae, suggesting its conservation across fungal species .

For researchers studying this protein, immunofluorescence double staining techniques using epitope-tagged versions (typically HA-tagged tvp38) co-stained with markers of different Golgi/endosomal compartments provides the most reliable localization data. When conducting such studies, it is critical to validate antibody specificity and use appropriate controls to distinguish true localization from potential artifacts .

How does tvp38 conservation appear across different species?

Tvp38 belongs to a protein family conserved across fungi and extends to higher eukaryotes, including humans . Phylogenetic analysis of tvp38 homologs shows distinct evolutionary relationships between fungal, plant, and animal variants.

Interestingly, some cyanobacterial homologs, particularly PMM0308 from Prochlorococcus marinus MED4, cluster with eukaryotic tvp38 proteins found in the secretory pathway, suggesting functional similarity despite evolutionary distance . This conservation implies an important physiological role in membrane trafficking that has been maintained throughout evolution.

When studying tvp38 across species, researchers should utilize multiple sequence alignment tools and consider constructing phylogenetic trees to establish evolutionary relationships that may inform functional studies.

What are the standard methods for expressing recombinant tvp38 protein?

Based on established protocols for membrane proteins, recombinant expression of tvp38 typically involves:

For experimental applications requiring functional protein, it is advisable to verify proper folding through circular dichroism or limited proteolysis approaches.

What experimental approaches can be used to investigate tvp38's role in vesicular trafficking?

Investigating tvp38's role in vesicular trafficking requires multifaceted approaches:

  • Genetic manipulation: Creating knockout or knockdown strains in model organisms. While tvp38 is nonessential for growth under laboratory conditions in S. cerevisiae , phenotypic analysis under various stress conditions may reveal functional importance.

  • Protein-protein interaction studies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling techniques (BioID or APEX)

    • Fluorescence resonance energy transfer (FRET)

  • Vesicle tracking assays: Live-cell imaging using fluorescently tagged tvp38 together with markers for different vesicle populations can help track its movement and localization during vesicular transport.

  • Cargo transport assays: Monitoring transport of model cargo proteins in cells with manipulated tvp38 levels to assess effects on trafficking rates and fidelity.

Given the protein's localization in Tlg2-containing compartments , particular attention should be paid to late Golgi and endosomal trafficking routes when designing such experiments.

How does tvp38 potentially contribute to Botryotinia fuckeliana pathogenicity?

Botryotinia fuckeliana (Botrytis cinerea) is a significant plant pathogen causing gray mould in crops like grapes and strawberries . While direct evidence linking tvp38 to pathogenicity is limited, several research approaches can test this relationship:

  • Comparative proteomics: Analysis of tvp38 expression levels during different infection stages compared to saprophytic growth.

  • Gene knockout studies: Creating tvp38-deficient B. fuckeliana strains and testing their virulence on host plants.

  • Secretion pathway analysis: As a Golgi membrane protein potentially involved in vesicular trafficking , tvp38 might affect secretion of virulence factors. Researchers could quantify extracellular enzyme activities and effector protein secretion in wild-type versus tvp38-deficient strains.

  • Host-pathogen interface studies: Investigating whether tvp38 influences the formation or function of infection structures like appressoria.

It's worth noting that B. fuckeliana is known for developing fungicide resistance , so understanding fundamental cellular processes including those involving tvp38 may provide insights into novel control strategies.

What are the challenges in purifying functional recombinant tvp38 with intact membrane domains?

Purifying functional membrane proteins presents several challenges:

  • Protein aggregation: Membrane proteins often aggregate when removed from their native lipid environment. For tvp38, optimizing detergent selection is crucial—mild non-ionic detergents (DDM, LMNG) typically preserve protein structure better than harsh ionic detergents.

  • Low expression levels: Membrane proteins typically express at lower levels than soluble proteins. When expressing B. fuckeliana tvp38, codon optimization for the host organism and growth at lower temperatures (16-20°C) may improve yields.

  • Protein stability: Once extracted, membrane proteins rapidly lose stability. Including glycerol (typically 50%) in storage buffers helps maintain tvp38 stability, as demonstrated in recombinant protein preparations .

  • Functional validation: Unlike enzymatic proteins, functional assays for membrane proteins like tvp38 are challenging. Researchers may need to develop binding assays or reconstitute the protein in liposomes to assess functionality.

  • Reconstitution difficulties: For structural studies or functional assays, reconstitution into artificial membranes may be necessary. Nanodiscs or liposomes with lipid compositions mimicking the Golgi membrane would be appropriate for tvp38.

When working with tvp38, researchers should consider these challenges and implement appropriate strategies to maintain protein integrity throughout the purification process.

How can researchers differentiate between the functions of tvp38 and other Golgi-associated proteins?

Differentiating the specific function of tvp38 from other Golgi-associated proteins requires several complementary approaches:

  • Genetic interaction studies: Systematic analysis of genetic interactions between tvp38 and other Golgi proteins can reveal functional relationships. Previous research has shown synthetic aggravation between tvp23 or tvp15 disruptions and ypt6 or ric1 null mutations , suggesting functional overlap or cooperation between these proteins.

  • Protein complex analysis: Defining the specific protein complexes containing tvp38 through techniques like Blue Native PAGE followed by mass spectrometry.

  • Domain-specific mutations: Creating targeted mutations in specific domains of tvp38 to disrupt particular functions while preserving others.

  • Cargo-specific trafficking assays: Analyzing the trafficking of multiple distinct cargo proteins in cells with manipulated tvp38 levels to identify specific pathways affected.

  • Compartment-specific markers: Using super-resolution microscopy with markers for different Golgi sub-compartments to precisely localize tvp38 and determine its distribution relative to other Golgi proteins.

Evidence suggests that Tvp23, Tvp18, and Tvp15 interact with Yip1-family proteins (Yip4 and Yip5), collectively assisting in maintaining late Golgi/endosomal compartments . Determining whether tvp38 participates in similar interactions would help clarify its specific role.

What methods are optimal for studying post-translational modifications of tvp38?

Studying post-translational modifications (PTMs) of tvp38 requires specialized approaches:

  • Mass spectrometry-based proteomics: LC-MS/MS analysis of purified tvp38 can identify various PTMs including phosphorylation, glycosylation, and ubiquitination. For membrane proteins like tvp38, optimized digestion protocols (combining trypsin with complementary proteases) improve sequence coverage.

  • Site-directed mutagenesis: Converting potential modification sites to non-modifiable residues (e.g., S/T→A for phosphorylation sites) and assessing functional consequences.

  • Modification-specific antibodies: Generating antibodies against specific modified forms of tvp38 for western blotting or immunoprecipitation studies.

  • In vitro modification assays: Incubating purified tvp38 with specific modifying enzymes (kinases, glycosyltransferases) to assess modification potential.

  • Pulse-chase experiments: For studying the dynamics of modifications throughout the protein lifecycle.

For membrane proteins like tvp38, special consideration should be given to modifications occurring in transmembrane domains or at membrane interfaces, as these can be technically challenging to detect but may be functionally significant.

How can ELISA be utilized to study Botryotinia fuckeliana tvp38?

ELISA (Enzyme-Linked Immunosorbent Assay) can be effectively employed to study tvp38 in various research contexts:

  • Quantification in complex samples: ELISA allows precise quantification of tvp38 in fungal extracts or recombinant preparations. Commercial recombinant Botryotinia fuckeliana tvp38 protein is available for standardization of such assays .

  • Analysis of protein expression levels: Developing tvp38-specific ELISAs enables monitoring of expression levels under different growth conditions or during infection processes.

  • Antibody validation: ELISA can validate the specificity and sensitivity of antibodies before their use in more complex applications like immunofluorescence or immunoprecipitation.

  • Interaction studies: Modified ELISA formats (pull-down ELISA) can assess interactions between tvp38 and candidate binding partners.

When developing ELISA protocols for tvp38, researchers should consider:

  • Using recombinant protein standards (50 μg quantities are typically sufficient)

  • Optimizing blocking conditions to prevent non-specific binding

  • Validating antibody specificity against related proteins

What approaches can be used to study evolutionary relationships between tvp38 homologs?

Studying evolutionary relationships between tvp38 homologs requires bioinformatic and experimental approaches:

  • Sequence-based phylogenetic analysis: Using tools like the Cobalt Constraint-based Multiple Protein Alignment Tool to generate phylogenetic trees of tvp38/DedA homologs across species . This reveals that some cyanobacterial proteins cluster with eukaryotic Tvp38 proteins, suggesting functional conservation.

  • Domain architecture analysis: Comparing the arrangement of conserved domains and motifs across species to identify functional modules maintained throughout evolution.

  • Functional complementation studies: Testing whether tvp38 homologs from different species can rescue phenotypes in tvp38-deficient yeast or other model organisms.

  • Synteny analysis: Examining the genomic context of tvp38 homologs across species to identify conserved gene neighborhoods that might indicate functional relationships.

The evolutionary conservation of tvp38 across fungi, plants, and animals suggests an important cellular function . Particular attention should be paid to the relationship between fungal tvp38 proteins and their homologs in plants, which may reveal insights relevant to host-pathogen interactions.

How can researchers effectively study tvp38's role in fungicide resistance mechanisms?

Given that Botryotinia fuckeliana (Botrytis cinerea) has a high risk of developing fungicide resistance , investigating tvp38's potential role in this process could yield valuable insights:

  • Expression analysis in resistant strains: Compare tvp38 expression levels between fungicide-sensitive and resistant B. fuckeliana strains using RT-qPCR or proteomics.

  • Genetic modification approaches: Create tvp38 overexpression or knockout strains and test their sensitivity to various fungicide classes, including anilinopyrimidines, fenhexamid, boscalid, and QoI fungicides .

  • Localization studies in treated fungi: Examine whether fungicide treatment alters tvp38 localization or abundance, potentially indicating involvement in stress response mechanisms.

  • Transport assays: As a vesicle-associated protein , tvp38 might influence fungicide efflux or compartmentalization. Researchers could measure fungicide accumulation in wild-type versus tvp38-modified strains.

  • Interaction with known resistance factors: Investigate potential interactions between tvp38 and known fungicide resistance determinants, such as target-site mutations in Erg27, SdhB, and cytb genes .

Research has shown that fungicide resistance in B. fuckeliana populations from table-grape vineyards and greenhouse-grown strawberries in southern Italy is quite common, with multiple fungicide resistance to 2-6 different modes of action frequently occurring . Understanding tvp38's potential contribution to these mechanisms could inform resistance management strategies.

What are the current contradictory findings regarding tvp38 function that require resolution?

Several areas of tvp38 research present contradictory or incomplete findings that merit further investigation:

  • Essentiality: While tvp38 is nonessential for growth in S. cerevisiae under laboratory conditions , its high conservation across species suggests important functions that may become apparent under specific conditions or in different organisms.

  • Functional redundancy: The relationship between tvp38 and other Tvp proteins (Tvp23, Tvp18, Tvp15) remains unclear. Some evidence suggests they may have overlapping functions in maintaining late Golgi/endosomal compartments , but the specific contribution of each protein requires clarification.

  • Cargo specificity: The putative role of tvp38 in cargo selection needs further exploration to determine whether it acts on specific cargo types or has broader functions in vesicular trafficking.

  • Pathogen-specific roles: Whether tvp38 has specialized functions in pathogenic fungi like B. fuckeliana, potentially contributing to virulence or stress adaptation, remains an open question.

Resolving these contradictions will require integrated approaches combining genetics, biochemistry, cell biology, and systems-level analyses in multiple model organisms.

What emerging technologies might advance tvp38 research in the next decade?

Several emerging technologies hold promise for advancing tvp38 research:

  • Cryo-electron microscopy: Determining the structure of tvp38 and its complexes at near-atomic resolution would provide crucial insights into function.

  • Super-resolution microscopy: Techniques like STORM or PALM could reveal the precise subcellular localization and dynamics of tvp38 with unprecedented detail.

  • Genome-wide CRISPR screens: Identifying genetic interactions on a genome-wide scale would place tvp38 function in broader cellular contexts.

  • Single-cell proteomics: Analyzing tvp38 expression and modification at the single-cell level could reveal cell-to-cell variability and responses to environmental changes.

  • In situ structural biology: Methods like cryo-electron tomography could visualize tvp38 in its native cellular environment, preserving contextual information.

  • Integrative multi-omics approaches: Combining transcriptomics, proteomics, metabolomics, and phenomics to understand tvp38 function in a systems biology framework.

These technologies, applied to both model organisms and agriculturally relevant fungi like B. fuckeliana, will likely resolve many outstanding questions about tvp38 function and its potential applications in biotechnology and agriculture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.