Recombinant Botryotinia fuckeliana Mitochondrial thiamine pyrophosphate carrier 1 (tpc1)

Shipped with Ice Packs
In Stock

Description

Botryotinia fuckeliana: Taxonomy and Significance

Botryotinia fuckeliana, commonly known by its anamorph name Botrytis cinerea, is a significant plant pathogen classified in the kingdom Fungi, phylum Ascomycota, subphylum Pezizomycotina, class Leotiomycetes, order Helotiales, and family Sclerotiniaceae . This haploid, filamentous, heterothallic ascomycete has garnered substantial scientific interest due to its devastating economic impact on agriculture worldwide . B. fuckeliana exhibits a necrotrophic lifestyle, attacking over 200 crop hosts, primarily dicotyledonous plant species, in temperate and subtropical regions . The pathogen causes soft rotting of aerial plant parts and post-harvest decay of vegetables, fruits, and flowers, producing the characteristic gray conidiophores that give the disease its common name - gray mold .

Molecular marker studies have revealed significant genetic variation within B. fuckeliana populations. Research conducted in the Champagne region of France identified two sympatric populations - one group (transposa) containing the transposable elements Boty and Flipper, while the other group (vacuma) lacked these elements . These populations exhibited distinct genetic characteristics across multiple markers, suggesting complex population dynamics within this fungal species. Additionally, the fungus demonstrates a concerning propensity for developing resistance to commonly used fungicides, with monitoring studies in southern Italy detecting resistant isolates at frequencies up to 100% for certain compounds .

Mitochondrial Carriers: Structure and Function

Mitochondrial carriers constitute a family of transport proteins that play essential roles in cellular metabolism by facilitating the movement of metabolites, nucleotides, and cofactors across mitochondrial membranes . These carriers share distinctive structural features, characterized by a tripartite structure consisting of three tandem sequence repeats with specific sequence motifs . Each repeat typically folds into two transmembrane α-helices connected by an extensive hydrophilic loop . This characteristic structure enables these proteins to perform specialized transport functions while maintaining the integrity of mitochondrial membranes.

Among the identified mitochondrial carriers are transporters for various essential molecules including FAD, folates, coenzyme A, dicarboxylates, ornithine, succinate-fumarate, oxaloacetate-sulfate, oxodicarboxylates, aspartate-glutamate, deoxynucleotides, glutamate, citrate, and adenine nucleotides . These carriers are crucial for maintaining proper mitochondrial function and supporting cellular metabolic processes.

Comparison with Other Mitochondrial Carriers

The B. fuckeliana tpc1 protein shares structural similarities with other mitochondrial carriers but exhibits distinct functional characteristics. Notably, it displays approximately 25% sequence identity with the human deoxynucleotide carrier (DNC), which represents its closest human homolog . Despite this sequence similarity, functional studies have demonstrated significant differences between these proteins. While DNC catalyzes obligatory counter-exchange, tpc1 can facilitate both uniport and exchange transport mechanisms . Furthermore, tpc1 efficiently transports ThPP and ThMP, whereas DNC does not demonstrate this capability .

Table 1: Comparison of Transport Properties Between tpc1 and Human DNC

PropertyB. fuckeliana tpc1Human DNC
Transport MechanismBoth uniport and exchangeObligatory counter-exchange
ThPP/ThMP TransportEfficientNot observed
Inhibition by CarboxyatractylosideUnaffectedAffected
Inhibition by Bongkrekic AcidUnaffectedAffected
Primary Physiological SubstratesThPP, ThMPDeoxynucleotides

This comparison highlights the specialized role of tpc1 in thiamine metabolism within fungal mitochondria, distinguishing it from other carriers despite structural similarities .

Role in Thiamine Metabolism

Thiamine pyrophosphate (ThPP) serves as an essential coenzyme for multiple enzymes in cellular metabolism. In fungi like Saccharomyces cerevisiae (which has been used as a model for understanding fungal thiamine metabolism), ThPP is required for the activity of five key enzymes: pyruvate decarboxylase and transketolase in the cytosol, and acetolactate synthase (ALS) and the E1 components of pyruvate dehydrogenase and oxoglutarate dehydrogenase (OGDH) in the mitochondria .

The subcellular distribution of enzymes involved in thiamine metabolism reveals that ThPP is synthesized in the cytosol by thiamine pyrophosphokinase and must subsequently be transported into mitochondria to support the activity of mitochondrial ThPP-dependent enzymes . This transport process is facilitated by tpc1, which functions primarily as a uniport carrier for ThPP uptake into mitochondria . Additionally, tpc1 catalyzes the exchange between cytosolic ThPP and intramitochondrial thiamine monophosphate (ThMP), which is generated through the hydrolysis of ThPP by mitochondrial ThPPase activity .

Transport Mechanisms and Kinetics

The transport activity of tpc1 exhibits distinctive kinetic properties. Research on the yeast ortholog has shown that the protein facilitates both uniport and exchange transport mechanisms, with transport activity being dependent on the pH gradient across the mitochondrial membrane . Both the uptake of ThPP and the exchange between external ThPP and internal ThMP are favored in energized mitochondria, as these substrates are co-transported with H+ in a manner dependent on the pH gradient .

The uniport function becomes particularly important under specific physiological conditions, such as during cell division or when cells transition from a medium containing branched-chain amino acids (valine, leucine, and isoleucine) to one without these amino acids . This adaptation allows for rapid adjustments in the intramitochondrial ThPP levels to support increased enzymatic activity, especially when the biosynthesis of acetolactate synthase is derepressed in the absence of branched-chain amino acids .

Potential Role in Fungal Pathogenicity

While direct evidence for the role of B. fuckeliana tpc1 in pathogenicity is limited, research on related fungi provides valuable insights. In Magnaporthe oryzae, the causative agent of rice blast disease, a TPC1 gene (though functioning as a transcription factor rather than a mitochondrial carrier) has been identified as a pathogenicity determinant . This finding suggests that proteins designated as TPC1 may have evolved diverse functions across fungal species while maintaining important roles in fungal growth and pathogenic potential.

Expression Systems

Recombinant Botryotinia fuckeliana Mitochondrial Thiamine Pyrophosphate Carrier 1 can be successfully expressed in various host systems. The most commonly utilized expression system is Escherichia coli, which offers advantages in terms of rapid growth, high protein yields, and well-established protocols . The recombinant protein is typically fused to an N-terminal His-tag to facilitate purification and detection . Alternative expression systems include yeast, baculovirus, and mammalian cell systems, which may be employed depending on the specific requirements for protein folding, post-translational modifications, or functional studies .

Table 2: Common Expression Systems for Recombinant B. fuckeliana tpc1

Expression SystemAdvantagesLimitationsTag Options
E. coliRapid growth, high yield, cost-effectiveLimited post-translational modificationsHis-tag (N-terminal)
YeastEukaryotic processing, moderate yieldLonger production timeHis-tag, GST
BaculovirusComplex eukaryotic processingTechnical complexity, costHis-tag, FLAG
Mammalian CellNative-like processingHighest cost, lowest yieldHis-tag, Fc

The choice of expression system depends on the intended application, with E. coli being preferred for structural studies and biochemical characterizations due to its efficiency in producing substantial quantities of the protein .

Purification Methods

Purification of recombinant B. fuckeliana tpc1 typically involves affinity chromatography utilizing the His-tag fusion . The general purification workflow includes:

  1. Bacterial cell lysis using appropriate buffer systems

  2. Initial clarification by centrifugation to remove cellular debris

  3. Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  4. Optional secondary purification steps such as ion exchange or size exclusion chromatography

  5. Quality assessment by SDS-PAGE to confirm purity

Using these methods, the recombinant protein can be purified to greater than 90% homogeneity as determined by SDS-PAGE analysis . The purified protein is typically obtained in a lyophilized powder form, which provides stability during storage and shipping .

Protein Quality Assessment

The quality of purified recombinant B. fuckeliana tpc1 is assessed using several analytical techniques:

  1. SDS-PAGE Analysis: Confirms the purity (≥90%) and molecular weight of the protein

  2. Western Blotting: Verifies the identity using anti-His antibodies

  3. Mass Spectrometry: Provides precise mass determination and sequence verification

  4. Functional Assays: Assesses the transport activity using reconstituted liposomes (when applicable)

These quality control measures ensure the consistency and reliability of the recombinant protein for downstream applications in research and development.

Reconstitution Protocol

For reconstitution of lyophilized recombinant B. fuckeliana tpc1, the following protocol is recommended:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (50% is commonly used)

  4. Aliquot for long-term storage at -20°C/-80°C

Repeated freezing and thawing should be avoided to prevent protein degradation and activity loss .

Stability Considerations

Several factors affect the stability of recombinant B. fuckeliana tpc1:

  1. Temperature: Higher temperatures accelerate degradation; storage at -80°C provides maximum stability

  2. pH: The protein is most stable in the pH range of 7.5-8.5

  3. Freeze-thaw Cycles: Multiple cycles significantly reduce activity

  4. Buffer Components: Presence of reducing agents and protease inhibitors can enhance stability

Following the recommended storage and handling guidelines ensures maintenance of protein integrity and functional activity for experimental applications.

Current Applications in Fungal Biology

Recombinant B. fuckeliana tpc1 serves as a valuable tool for investigating various aspects of fungal biology:

  1. Mitochondrial Transport Studies: The recombinant protein can be reconstituted into liposomes to study the mechanisms and kinetics of thiamine pyrophosphate transport

  2. Structural Biology: Provides material for crystallographic or cryo-EM studies to determine three-dimensional structure

  3. Protein-Protein Interaction Analysis: Facilitates identification of interaction partners within mitochondrial membranes

  4. Antibody Development: Serves as an antigen for generating specific antibodies for localization and functional studies

These applications contribute to our understanding of fungal mitochondrial metabolism and the role of cofactor transport in cellular function.

Potential in Antifungal Drug Development

Given the importance of mitochondrial metabolism in fungal growth and pathogenicity, tpc1 represents a potential target for antifungal drug development. Several aspects make it an attractive candidate:

  1. Essentiality: ThPP-dependent enzymes play crucial roles in central metabolism

  2. Selectivity: Differences between fungal and human orthologs may allow for selective targeting

  3. Accessibility: As a membrane protein, it may be accessible to small molecule inhibitors

The development of specific inhibitors targeting B. fuckeliana tpc1 could potentially lead to novel antifungal strategies for controlling gray mold disease in agricultural settings.

Future Research Directions

Several promising research avenues remain to be explored:

  1. Structural Characterization: Determination of the three-dimensional structure would provide insights into the transport mechanism and substrate specificity

  2. In vivo Function: Generation of tpc1 knockouts in B. fuckeliana to directly assess its role in growth, metabolism, and pathogenicity

  3. Comparative Analysis: Systematic comparison with tpc1 orthologs from other pathogenic fungi to identify conserved features and species-specific adaptations

  4. Regulation Studies: Investigation of the regulatory mechanisms controlling tpc1 expression under different environmental conditions and during pathogenesis

These research directions would significantly advance our understanding of this important mitochondrial carrier and its role in fungal biology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchase method or location. For precise delivery details, please consult your local distributors.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
tpc1; BC1G_13653; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-322
Protein Length
full length protein
Species
Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)
Target Names
tpc1
Target Protein Sequence
MSESAEHLKDEGSKTQSMIAGATAGLIARFVIAPLDVVKIRLQLQSHSASDPLSQRDLRG SPIYKGTIPTIKRIFREEGLAALWKGNVPAELMYVSYSAIQFTTYRSVTLGLQDAFGEHR LPAAAESFIAGASAGAVATTATYPLDLLRTRFAAQGIERVYTSLRSSIRDIAISEGPRGF FQGLGAGVGQIVPYMGIFFATYESLRLPMGTLNMPFGSADASAGVIASVIAKTGIFPFDL IRKRLQVQGPTRERYVHKNIPVYNGVFQTMRHILHNEGYRGLYRGLTVSLFKSAPASAVT MWTYERVLGILLKWEKSQELSK
Uniprot No.

Target Background

Function
This mitochondrial transporter facilitates the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Botryotinia fuckeliana Mitochondrial Thiamine Pyrophosphate Carrier 1 (Tpc1) and what is its primary function?

Tpc1 is a mitochondrial carrier protein that belongs to the mitochondrial carrier family responsible for transporting metabolites, nucleotides, and cofactors across the inner mitochondrial membrane. The primary function of Tpc1 in Botryotinia fuckeliana (the teleomorph of Botrytis cinerea) is to import thiamine pyrophosphate (ThPP) into mitochondria, where this essential cofactor is required for several enzymatic reactions.

The protein functions predominantly by catalyzing the exchange of cytosolic ThPP with intramitochondrial molecules like ATP or ADP. Experimental evidence demonstrates that Tpc1 can operate in both uniport mode (transporting ThPP in one direction) and antiport mode (exchanging ThPP for another substrate), with the antiport mechanism being more efficient for ThPP transport .

How is the genetic structure of Botryotinia fuckeliana related to Tpc1 expression?

Botryotinia fuckeliana, as the teleomorph (sexual stage) of Botrytis cinerea, exhibits significant genetic variation that can influence Tpc1 expression. Molecular marker studies have revealed that this haploid, filamentous, heterothallic ascomycete contains extensive intrapopulation genetic variation .

In the Champagne region of France, two sympatric populations of B. fuckeliana have been identified using RFLP markers:

  • The "transposa" group: Contains transposable elements Boty and Flipper

  • The "vacuma" group: Lacks these transposable elements

These populations differ in their genetic markers, with the transposa group appearing to be locally adapted, while the vacuma group seems to be a heterogeneous migrant population . While there are no specific data in the search results directly linking these genetic populations to differential Tpc1 expression, this genetic diversity likely influences various physiological processes including mitochondrial transport mechanisms.

The tpc1 gene in B. fuckeliana is designated as BC1G_13653, and its expression may be regulated differently depending on growth conditions, particularly in response to fermentable versus non-fermentable carbon sources, as observed in related species .

What are the optimal conditions for recombinant expression and purification of Botryotinia fuckeliana Tpc1?

The recommended protocol for recombinant expression and purification of B. fuckeliana Tpc1 involves:

Expression System:

  • E. coli is the preferred expression system for recombinant Tpc1 production

  • The gene encoding the full-length protein (1-322 amino acids) is typically fused to an N-terminal His-tag

Expression Conditions:

  • Expression is typically induced at mid-log phase (OD600 = 0.6-0.8)

  • Optimal induction temperature is 30°C for 4-6 hours or 18°C overnight

  • Addition of 0.1-1.0 mM IPTG for induction

Purification Protocol:

  • Cell lysis in Tris/PBS-based buffer (pH 8.0)

  • Extraction of membrane proteins using detergent (1.8% sarkosyl has been successfully used)

  • Clarification by centrifugation at high speed (258,000 g for 1 hour)

  • Affinity chromatography using Ni-NTA or similar metal affinity resin

  • Optional further purification by size exclusion or ion exchange chromatography

  • Lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Storage Recommendations:

  • Store lyophilized protein at -20°C/-80°C

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

Quality Control:

  • Purity should be greater than 90% as determined by SDS-PAGE

  • Functionality can be verified through reconstitution in liposomes and transport assays

How can the transport activity of recombinant Tpc1 be measured in proteoliposomes?

The transport activity of recombinant Tpc1 can be measured using the following methodologies:

Reconstitution into Liposomes:

  • Solubilize purified Tpc1 in 1.8% sarkosyl (w/v)

  • Remove residual insoluble material by centrifugation (258,000 g, 1 hour)

  • Reconstitute the solubilized protein into liposomes containing buffer A (30 mM MES/30 mM HEPES, pH 7.0) with or without substrate

  • Remove external substrate by passing proteoliposomes through Sephadex G-75 columns pre-equilibrated with buffer A

Transport Assays:

  • Homo-exchange assay:

    • Load proteoliposomes with a specific substrate (e.g., 10 mM dATP)

    • Initiate transport by adding the same substrate labeled with a radioactive isotope (e.g., [α-35S]dATP)

    • Measure the exchange of internal unlabeled substrate with external labeled substrate

  • Hetero-exchange assay:

    • Load proteoliposomes with various potential substrates

    • Add a single radioactively labeled substrate externally (e.g., [α-35S]dATP)

    • Measure the uptake of the labeled substrate in exchange with different internal substrates

  • Uniport assay:

    • Use unloaded proteoliposomes (containing only buffer)

    • Add labeled substrate externally

    • Measure the unidirectional transport into proteoliposomes

  • Efflux measurements:

    • Load proteoliposomes with substrate (e.g., 1 mM dATP) and label with carrier-free [α-35S]dATP via carrier-mediated exchange equilibration

    • Remove external radioactivity by passing through Sephadex G-75

    • Initiate efflux by adding unlabeled external substrate or buffer alone

    • Measure the release of internal labeled substrate

Termination and Quantification:

  • Transport is terminated by adding inhibitors (60 μM p-CMBS and 20 mM bathophenanthroline)

  • Entrapped radioactivity is measured by scintillation counting

  • Control values (inhibitors added with labeled substrate) are subtracted from experimental values

  • Initial transport rates are calculated from radioactivity taken up by proteoliposomes after 3 minutes (in the initial linear range)

What is the substrate specificity of Botryotinia fuckeliana Tpc1 and how does it compare to related proteins?

Tpc1 from B. fuckeliana exhibits distinct substrate specificity that differentiates it from other mitochondrial carriers. Based on reconstitution experiments:

Primary Substrates with High Transport Activity:

  • Thiamine pyrophosphate (ThPP)

  • Thiamine monophosphate (ThMP)

Secondary Substrates with Significant Transport Activity:

  • Deoxynucleotides: dAMP, dADP, dATP

  • Nucleotides: AMP, ADP, ATP, 3'-AMP, 3',5'-ADP

  • Nucleotides of C, T, U, and G (transported with slightly lower efficiency than A derivatives)

Non-transported Compounds:

  • Thiamine

  • Nucleosides (including adenosine)

  • Purines and pyrimidines

  • Cyclic AMP (cAMP)

  • Nicotinamide mononucleotide (NMN)

  • Coenzyme A (CoA)

  • S-adenosylmethionine (SAM)

  • Various metabolites including phosphate, pyruvate, malonate, succinate, malate, oxoglutarate, citrate, carnitine, amino acids

Transport Efficiency Hierarchy:
For nucleotides: NMP > NDP > NTP
For bases: A > C, T, U, G (slight preference)

Comparative Analysis with Other Species:
Tpc1 from B. fuckeliana shares functional similarities with Tpc1 proteins from other fungi, but exhibits distinct evolutionary relationships. In comparison:

  • Saccharomyces cerevisiae Tpc1p: Similarly transports ThPP and ThMP, but shows some differences in regulation and expression patterns. The yeast Tpc1p is especially expressed under fermentative conditions .

  • Drosophila melanogaster DmTpc1p: Transports ThPP and, to a lesser extent, pyrophosphate, ADP, ATP, and other nucleotides. DmTpc1p can complement S. cerevisiae tpc1Δ growth defects on fermentable carbon sources .

  • Human Deoxynucleotide Carrier (DNC): Despite being the closest sequence relative to yeast Tpc1p (25% identity), DNC has distinct functions. Unlike Tpc1p, DNC catalyzes obligatory counter-exchange only (not uniport), doesn't transport ThPP efficiently, and is affected by carboxyatractyloside and bongkrekic acid inhibitors .

What genetic approaches can be used to study Tpc1 function in Botryotinia fuckeliana?

Several genetic approaches can be employed to study Tpc1 function in B. fuckeliana:

1. Gene Deletion/Knockout:

  • Target deletion of the tpc1 gene (BC1G_13653) using homologous recombination

  • Analysis of deletion mutants for growth phenotypes, ThPP levels, and activities of ThPP-dependent enzymes

  • Complementation assays with the wild-type gene to confirm phenotype causality

2. Sexual Crosses and Progeny Analysis:
B. fuckeliana (as the teleomorph of Botrytis cinerea) can be studied through sexual crosses:

  • Cross strains with different tpc1 alleles

  • Analyze progeny for mitochondrial traits (which show maternal inheritance)

  • Study segregation patterns to confirm mitochondrial genome location

3. Heterologous Expression:

  • Express B. fuckeliana tpc1 in model organisms like S. cerevisiae

  • Complement tpc1Δ yeast mutants to assess functional conservation

  • Study protein function in a well-characterized genetic background

4. Site-Directed Mutagenesis:

  • Generate point mutations in conserved residues of the tpc1 gene

  • Express mutant proteins and characterize their transport properties

  • Identify critical residues for substrate binding and transport

5. Expression Analysis:

  • Quantify tpc1 expression under different growth conditions

  • Determine if expression is regulated by carbon source, as in S. cerevisiae

  • Analyze promoter elements controlling expression

6. Cytochrome b Gene Analysis for Mitochondrial Studies:
Since Tpc1 is a mitochondrial protein, analysis of mitochondrial DNA can provide context:

  • PCR amplification of cytochrome b gene fragments

  • Analysis of intronic sequence variants in the cytb gene

  • Study of different structural variants (with or without the 1205 bp intron between codons 143 and 144)

How can Tpc1 be used as a model for studying mitochondrial carrier proteins in fungal pathogens?

Tpc1 from B. fuckeliana serves as an excellent model for studying mitochondrial carrier proteins in fungal pathogens for several reasons:

1. Functional Conservation and Divergence:

  • Tpc1 proteins are conserved across fungal species with varying degrees of sequence identity

  • Comparative studies between B. fuckeliana Tpc1 and homologs from other fungi (S. cerevisiae, Aspergillus spp., Sclerotinia sclerotiorum, etc.) can reveal functional adaptations

  • Sequence alignment and phylogenetic analysis can identify conserved domains critical for transport function

2. Metabolic Adaptations in Plant Pathogens:

  • B. fuckeliana is a significant plant pathogen causing gray mold disease

  • Tpc1 function may be linked to pathogenicity through its role in energy metabolism

  • Comparison with non-pathogenic fungi can highlight metabolic adaptations specific to pathogenesis

3. Evolutionary Studies:

  • Evolutionary relationships between Tpc1 proteins across different fungal species can be examined

  • The presence of multiple isoforms in some species suggests functional specialization

  • Molecular phylogeny can reveal clues about the evolution of substrate specificity

4. Structural Biology Applications:

  • Recombinant expression and purification protocols for B. fuckeliana Tpc1 can be adapted for structural studies

  • Crystallization trials and structural determination can provide insights into the molecular mechanism of transport

  • Structure-function relationships can be established through mutational analyses

5. Drug Target Potential:

  • As an essential component of mitochondrial metabolism, Tpc1 represents a potential target for antifungal development

  • Differences between fungal and human mitochondrial carriers can be exploited for selective inhibition

  • High-throughput screening assays using reconstituted Tpc1 can identify potential inhibitors

6. Model System for Genetic Analysis:

  • B. fuckeliana offers advantages as a genetic system due to its ability to undergo sexual reproduction

  • The maternal inheritance of mitochondrial traits can be studied through sexual crosses

  • Gene manipulation techniques established for B. fuckeliana can be applied to study Tpc1 function in vivo

What are common challenges in expression and purification of recombinant Tpc1 and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Tpc1:

Challenge: Low expression levels

  • Solution: Optimize codon usage for the expression host

  • Solution: Test different expression strains (BL21(DE3), Rosetta, C41/C43)

  • Solution: Reduce induction temperature to 18-20°C and extend expression time

  • Solution: Test different fusion tags (His6, GST, MBP) to improve solubility

Challenge: Protein aggregation during expression

  • Solution: Express protein at lower temperatures (16-20°C)

  • Solution: Include compatible solutes (glycerol, sorbitol) in growth media

  • Solution: Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Solution: Try expression as inclusion bodies followed by refolding

Challenge: Poor solubilization of membrane proteins

  • Solution: Screen different detergents beyond sarkosyl (DDM, LDAO, Triton X-100)

  • Solution: Optimize detergent concentration for efficient solubilization

  • Solution: Test different solubilization buffers and pH conditions

  • Solution: Consider stepwise solubilization protocols

Challenge: Loss of activity during purification

  • Solution: Include stabilizers like glycerol or trehalose in all buffers

  • Solution: Minimize time between solubilization and reconstitution

  • Solution: Maintain low temperature (4°C) throughout purification

  • Solution: Include protease inhibitors to prevent degradation

Challenge: Poor reconstitution efficiency into liposomes

  • Solution: Optimize lipid composition (mixture of PC, PE, and cardiolipin)

  • Solution: Test different detergent removal methods (dialysis, Bio-Beads, gel filtration)

  • Solution: Adjust protein-to-lipid ratio (typically 1:50 to 1:100 w/w)

  • Solution: Monitor reconstitution efficiency by freeze-fracture electron microscopy

Challenge: Variability in transport assays

  • Solution: Ensure complete removal of external substrate

  • Solution: Standardize proteoliposome size through extrusion

  • Solution: Use internal controls for each batch of proteoliposomes

  • Solution: Maintain consistent temperature during transport measurements

How can researchers distinguish between different isoforms of mitochondrial carriers in transport studies?

Distinguishing between different isoforms of mitochondrial carriers presents significant challenges in transport studies. Here are methodological approaches to address this issue:

1. Heterologous Expression and Reconstitution:

  • Express individual carrier isoforms heterologously

  • Purify each isoform to homogeneity

  • Reconstitute purified proteins into liposomes

  • Perform comparative transport assays to establish isoform-specific profiles

2. Substrate Specificity Profiling:

  • Conduct comprehensive substrate screens for each isoform

  • Measure transport kinetics (Km, Vmax) for shared substrates

  • Identify unique substrates or dramatic differences in affinity

  • Create a "fingerprint" of transport characteristics for each carrier

3. Inhibitor Sensitivity:

  • Test sensitivity to known inhibitors of mitochondrial carriers

  • Identify isoform-specific inhibitors where possible

  • Determine IC50 values for various inhibitors

  • Use inhibitor profiles to distinguish between isoforms

4. Kinetic Analysis:

  • Measure detailed kinetic parameters (Km, Vmax, Ki)

  • Determine temperature dependence of transport

  • Analyze pH-dependence profiles

  • Study inhibition patterns (competitive, non-competitive, uncompetitive)

5. Genetic Approaches:

  • Generate knockout/knockdown strains for specific isoforms

  • Complement with individual isoforms to restore function

  • Perform cross-species complementation assays

  • Use site-directed mutagenesis to alter key residues

6. Immunological Methods:

  • Develop isoform-specific antibodies

  • Use immunoprecipitation to isolate specific carriers

  • Perform western blotting to quantify expression levels

  • Detect carriers in reconstituted systems using antibodies

7. Mass Spectrometry Analysis:

  • Use targeted proteomics to identify and quantify specific isoforms

  • Analyze post-translational modifications

  • Perform cross-linking studies followed by MS analysis

  • Study protein-protein interactions using affinity purification coupled with MS

8. Computational Approaches:

  • Develop machine learning algorithms to distinguish transport patterns

  • Use molecular dynamics simulations to predict substrate interactions

  • Model transport kinetics to differentiate between carrier mechanisms

  • Apply statistical methods to analyze complex transport data

What are the key considerations for designing experiments to study the physiological role of Tpc1 in Botryotinia fuckeliana?

When investigating the physiological role of Tpc1 in B. fuckeliana, researchers should consider the following experimental design elements:

1. Growth Conditions and Media Composition:

  • Compare growth on fermentable versus non-fermentable carbon sources

  • Test growth with and without thiamine supplementation

  • Examine effects of branched-chain amino acid supplementation

  • Evaluate growth under different oxygen conditions (aerobic vs. anaerobic)

2. Genetic Manipulation Strategies:

  • Generate tpc1 knockout mutants using CRISPR-Cas9 or homologous recombination

  • Create conditional expression systems for tpc1 using inducible promoters

  • Develop fluorescently tagged Tpc1 constructs for localization studies

  • Implement complementation assays with mutated versions of tpc1

3. Metabolic Analysis:

  • Measure intracellular and mitochondrial ThPP levels using HPLC or enzymatic assays

  • Quantify activities of ThPP-dependent enzymes (ALS, OGDH, pyruvate dehydrogenase)

  • Perform global metabolomic profiling to identify altered metabolic pathways

  • Use 13C-labeling to track carbon flux through central metabolism

4. Stress Response Evaluation:

  • Test sensitivity to oxidative stress (H2O2, paraquat)

  • Examine response to mitochondrial stress inducers

  • Assess growth under nutrient limitation conditions

  • Investigate adaptation to temperature stress

5. Pathogenicity Assays:

  • Compare virulence of wild-type and tpc1 mutant strains on plant hosts

  • Quantify infection efficiency, lesion development, and sporulation

  • Analyze secretion of virulence factors and cell wall-degrading enzymes

  • Test host range and tissue specificity of infection

6. Mitochondrial Function Assessment:

  • Measure oxygen consumption rates in intact cells and isolated mitochondria

  • Determine mitochondrial membrane potential using fluorescent probes

  • Assess production of reactive oxygen species

  • Analyze mitochondrial morphology and dynamics using microscopy

7. Molecular Interaction Studies:

  • Identify protein interaction partners using co-immunoprecipitation

  • Perform crosslinking studies to capture transient interactions

  • Use split-reporter assays to confirm protein-protein interactions in vivo

  • Characterize potential regulatory mechanisms affecting Tpc1 function

8. Comparative Analysis Across Conditions:

  • Examine tpc1 expression and Tpc1 protein levels under different growth conditions

  • Compare wild-type and mutant phenotypes across diverse environmental settings

  • Assess compensatory mechanisms activated in tpc1 mutants

  • Investigate potential functional redundancy with other transporters

By systematically addressing these considerations, researchers can develop a comprehensive understanding of the physiological role of Tpc1 in B. fuckeliana and its contribution to fungal metabolism, development, and pathogenicity.

What are promising avenues for future research on Botryotinia fuckeliana Tpc1?

Several promising research directions could advance our understanding of B. fuckeliana Tpc1:

1. Structural Biology Approaches:

  • Determine the high-resolution structure of Tpc1 using X-ray crystallography or cryo-EM

  • Characterize conformational changes during transport cycle using spectroscopic techniques

  • Identify binding sites for ThPP and other substrates through structure-guided mutagenesis

  • Model substrate translocation pathways using molecular dynamics simulations

2. Systems Biology Integration:

  • Integrate Tpc1 function into genome-scale metabolic models of B. fuckeliana

  • Use flux balance analysis to predict metabolic consequences of Tpc1 dysfunction

  • Perform multi-omics studies (transcriptomics, proteomics, metabolomics) to characterize global responses to Tpc1 perturbation

  • Develop mathematical models of mitochondrial transport networks

3. Regulation and Post-translational Modifications:

  • Investigate transcriptional regulation of tpc1 expression

  • Identify potential post-translational modifications of Tpc1

  • Study protein turnover and stability under different physiological conditions

  • Examine potential regulation by protein-protein interactions

4. Pathogenicity and Host Interaction:

  • Establish connections between Tpc1 function and virulence mechanisms

  • Investigate the role of mitochondrial metabolism in host adaptation

  • Study the impact of host-derived factors on Tpc1 activity

  • Develop strategies to target Tpc1 for disease control

5. Comparative Analysis Across Fungal Species:

  • Expand functional characterization to Tpc1 homologs from diverse fungal pathogens

  • Identify species-specific adaptations in transport properties

  • Correlate evolutionary changes with ecological niches and host ranges

  • Explore potential horizontal gene transfer events in mitochondrial carrier evolution

6. Advanced Transport Mechanisms:

  • Characterize transport mechanisms at the single-molecule level

  • Study the oligomeric state of Tpc1 in membranes using native mass spectrometry

  • Investigate potential coupling with other mitochondrial processes

  • Explore interaction with the mitochondrial membrane potential

7. Therapeutic Applications:

  • Screen for specific inhibitors of fungal Tpc1 proteins

  • Design structure-based inhibitors targeting unique features of fungal carriers

  • Evaluate combination approaches targeting multiple aspects of mitochondrial function

  • Develop delivery systems for mitochondria-targeted antifungals

How might advanced technologies enhance our understanding of Tpc1 function?

Emerging technologies offer significant potential to advance our understanding of Tpc1 function:

1. CRISPR-Based Technologies:

  • CRISPR-Cas9 for precise gene editing and functional genomics

  • CRISPRi/CRISPRa for modulating tpc1 expression without complete knockout

  • Base and prime editing for introducing specific mutations without double-strand breaks

  • CRISPR screening to identify genetic interactions with tpc1

2. Advanced Imaging Techniques:

  • Super-resolution microscopy to visualize Tpc1 distribution in mitochondria

  • Single-molecule tracking to monitor Tpc1 dynamics in living cells

  • Correlative light and electron microscopy to connect function with ultrastructure

  • Label-free imaging techniques to study native protein in membranes

3. Structural Biology Innovations:

  • Cryo-electron microscopy for high-resolution structures without crystallization

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Solid-state NMR to study Tpc1 in a membrane environment

  • Microcrystal electron diffraction for structural analysis of membrane proteins

4. Single-Vesicle Transport Assays:

  • Fluorescent techniques to monitor transport in single vesicles

  • Patch-clamp of reconstituted transporters to measure electrogenic transport

  • Microfluidic platforms for high-throughput transport assays

  • Development of real-time transport sensors based on fluorescent indicators

5. Artificial Intelligence and Machine Learning:

  • Prediction of protein-substrate interactions using deep learning

  • Identification of functional motifs through pattern recognition

  • Modeling of complex transport kinetics using neural networks

  • Automated design of specific inhibitors targeting fungal Tpc1

6. Mitochondrial Medicine Approaches:

  • Development of mitochondria-targeted drug delivery systems

  • Exploitation of species-specific differences for selective targeting

  • Design of mitochondrial function modulators based on transporter interactions

  • Engineering of synthetic transporters with enhanced or novel functions

7. Multi-Omics Integration:

  • Integration of genomics, transcriptomics, proteomics, and metabolomics data

  • Temporal profiling of responses to Tpc1 perturbation

  • Spatial mapping of mitochondrial heterogeneity within fungal cells

  • Network analysis to position Tpc1 within global cellular pathways

8. Synthetic Biology Tools:

  • Creation of orthogonal transport systems for probing mitochondrial function

  • Engineering of transporters with altered substrate specificity or regulation

  • Development of synthetic genetic circuits to control Tpc1 expression

  • Design of biosensors for monitoring mitochondrial ThPP levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.