Recombinant Botryotinia fuckeliana pH-response regulator protein palH/RIM21 (palH)

Shipped with Ice Packs
In Stock

Description

Protein Overview

palH is a transmembrane protein involved in pH-responsive signaling pathways. In its recombinant form, it is produced in Escherichia coli with a His-tag for purification and experimental tracking . Key features include:

AttributeDetails
UniProt IDQ5V9L7
SpeciesBotryotinia fuckeliana
Protein Length742 amino acids (Full Length)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer (6% Trehalose, pH 8.0)

Functional Role in pH Signaling

palH is a homolog of Saccharomyces cerevisiae Rim21p and Aspergillus nidulans PalH, which are central to ambient pH sensing . Mechanistically:

  • pH Sensing: Forms a complex with PalI (a 4-transmembrane protein) to detect alkaline conditions .

  • Signal Transduction: Triggers phosphorylation and ubiquitination of the arrestin-related protein PalF (Rim8p in yeast), leading to endocytosis of the PalF-PalH complex .

  • Downstream Activation: Facilitates proteolytic cleavage of the transcription factor RIM101, which regulates genes involved in pH adaptation and virulence .

This pathway enables B. fuckeliana to colonize host tissues by modulating extracellular enzyme secretion (e.g., pectinases, proteases) .

Pathogenicity Insights

Genetic studies of B. fuckeliana reveal two sympatric populations (transposa and vacuma) with differing virulence strategies . Recombinant palH aids in dissecting how pH signaling contributes to host-specific adaptation, particularly in degrading plant cell walls via enzymes such as polygalacturonases (PGs) .

Future Directions

Further studies are needed to:

  • Characterize palH’s role in B. fuckeliana’s "overkill" strategy of secreting redundant virulence factors .

  • Explore its interaction with plant defense mechanisms, such as reactive oxygen species (ROS) induction .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
palH; BC1G_07501; pH-response regulator protein palH/RIM21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-742
Protein Length
full length protein
Species
Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)
Target Names
palH
Target Protein Sequence
MDPRQLINNLKPSSTSAATATHPHCTPFTLPSNGVINLGASEYFTLTTNAIFNPECTGTA DIVLTGAGTPTSFVDLRDPFYASTIPACYALAATTVIAYMLVIMLLITPRTFLVQGAVVL GRRGFTNGPSGSDAGIGIGGRPWLQKVAALTVAISLTIATADTFRVAEQQYELGLMNASA LQEEVEGGMELKIIRIISDTFLWLAQAQTLIRLFPRQREKIIIKWTGFALISLDVLFSLL NNFVYNGNSRPRLFTDAVPALAYLFQLALSLLYCAWVIYYAISKKRYAFYHPKMRNIFLV AILSLVSVLVPVVFFVLDISKPTLAAWGDYVRWVGAAAASVVVWEWVERIEALERDEKKD GVLGREVFDGDEMLEVTPTSDWTKRFRKDNDDKGGTATGSTWPAMSGLANRYRSHATNDL ETGSVPGQRTGRHLLAVRPPLWPTRPQPAATPINRADTASAESTAYTVRYHPISEATPPI ISGDTTLSRSNSEAISISRSISNEEVDSDKPVVLEQTNQAAAVAAGLHNWQWNSLNPFKH RVQGPPAEVSLHTAKPPTPFSSHESSNKWDVRARIEGFAATQAERFREKTRPTVDTDPLP LTVIPAPSRRRAVATESEESDTDSISPTPDESSHIEVTTSRRDRPARTTDPYTPDSLNQH SITHRGSISFATAVQPELDQRVENATASPTLVGSRQTPTFSSSRSSPITVRSPVTPSLPP IIDGLPVTTIPAPPRRPRVENP
Uniprot No.

Target Background

Function
Essential for the proteolytic cleavage of the transcription factor pacC in response to alkaline pH. It may function as a pH sensor.
Database Links
Protein Families
PalH/RIM21 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Botryotinia fuckeliana pH-response regulator protein palH/RIM21?

Botryotinia fuckeliana pH-response regulator protein palH/RIM21 is a full-length 742 amino acid integral membrane protein that functions as a pH sensor molecule in the fungal pH response pathway . The protein contains multiple transmembrane domains anchoring it to the plasma membrane, where it detects environmental pH changes and initiates signaling cascades. In research contexts, recombinant versions are typically expressed with N-terminal His-tags to facilitate purification and experimental manipulation . The protein plays a role analogous to other fungal pH sensors like Rim21 in Saccharomyces cerevisiae and PalH in Aspergillus nidulans, though with species-specific adaptations .

The functional importance of palH/RIM21 lies in its ability to detect and respond to ambient pH changes, which is critical for fungal adaptation to varying environmental conditions. Studies of homologous proteins suggest that palH/RIM21 likely forms part of a multiprotein complex at the plasma membrane, working together with auxiliary proteins to sense pH changes and transduce signals to downstream components . This function is essential for the fungus to regulate gene expression appropriately in response to environmental pH, enabling adaptation to different ecological niches.

The protein's central role in pH sensing makes it a valuable subject for research into fungal environmental adaptation mechanisms, particularly given that Botryotinia fuckeliana (the teleomorph of Botrytis cinerea) is an important plant pathogen with significant agricultural impact . Understanding the molecular mechanisms of pH sensing could potentially lead to novel strategies for controlling fungal diseases.

What is the amino acid sequence and structural characteristics of palH/RIM21?

The complete amino acid sequence of Botryotinia fuckeliana pH-response regulator protein palH/RIM21 consists of 742 amino acids. The full sequence is as follows: MDPRQLINNLKPSSTSAATATHPHCTPFTLPSNGVINLGASEYFTLTTNAIFNPECTGTADIVLTGAGTPTSFVDLRDPFYASTIPACYALAATTVIAYMLVIMLLITPRTFLVQGAVVLGRRGFTNGPSGSDAGIGIGGRPWLQKVAALTVAISLTIATADTFRVAEQQYELGLMNASALQEEVEGGMELKIIRIISDTFLWLAQAQTLIRLFPRQREKIIIKWTGFALISLDVLFSLNNFVYNGNSRPRLFTDAVPALAYLFQLALSLLYCAWVIYYAISKKRYAFYHPKMRNIFLVAILSLVSVLVPVVFFVLDISKPTLAAWGDYVRWVGAAAASVVVWEWVERIEALERDEKKDGVLGREVFDGDEMLEVTPTSDWTKRFRKDNDDKGGTATGSTWPAMSGLANRYRSHATNDLETGSVPGQRTGRHLLAVRPPLWPTRPQPAATPINRADTASAESTAYTVRYHPISEATPPIISGDTTLSRSNSEAISISRSISNEEVDSDKPVVLEQTNQAAAVAAGLHNWQWNSLNPFKHRVQGPPAEVSLHTAKPPTPFSSHESSNKWDVRARIEGFAATQAERFREKTRPTVDTDPLPLTVIPAPSRRRAVATESEESDTDSISPTPDESSHIEVTTSRRDRPARTTDPYTPDSLNQHSITHRGSISFATAVQPELDQRVENATASPTLVGSRQTPTFSSSRSSPITVRSPVTPSLPPIIDGLPVTTIPAPPRRPRVENP .

Structurally, palH/RIM21 contains multiple transmembrane domains that anchor it to the plasma membrane, interspersed with cytoplasmic and extracellular regions involved in signal transduction and potentially interaction with other proteins. While the complete three-dimensional structure has not been fully resolved, functional studies of homologous proteins suggest that palH/RIM21 adopts a conformation allowing it to detect changes in plasma membrane properties associated with pH shifts . The protein likely contains domains for interaction with auxiliary proteins that help maintain its proper localization and stability.

Comparative sequence analysis with homologous proteins from other fungi reveals both conserved domains critical for pH sensing function and species-specific regions that may reflect adaptation to particular ecological niches. These structural features collectively enable palH/RIM21 to function effectively as a pH sensor, detecting environmental pH changes and initiating appropriate cellular responses.

How does the pH-sensing mechanism of palH/RIM21 function?

Based on studies of homologous proteins, palH/RIM21 functions as a primary sensor molecule in the fungal pH response pathway by detecting changes in plasma membrane properties associated with ambient pH fluctuations. Evidence from research on Rim21 in yeast suggests that plasma membrane depolarization serves as a key signal for pH sensing . When the external environment becomes alkaline, the resulting plasma membrane depolarization is detected by the sensor protein, triggering the pH response pathway . This mechanism appears to be conserved across fungal species, suggesting a similar function for palH/RIM21 in Botryotinia fuckeliana.

Intriguingly, the pH-sensing pathway can be activated even without external alkalization through treatments that cause plasma membrane depolarization, such as protonophore treatment or depletion of phosphatidylserine in the inner leaflet of the plasma membrane . This finding indicates that membrane potential changes, rather than direct detection of hydrogen ion concentration, may be the primary signal sensed by palH/RIM21. The protein's multiple transmembrane domains likely play crucial roles in detecting these membrane potential changes.

Upon activation, palH/RIM21 initiates a signaling cascade that ultimately leads to activation of pH-responsive transcription factors, controlling the expression of genes needed for adaptation to the prevailing pH conditions. In Aspergillus nidulans, this involves the PacC transcription factor, which undergoes proteolytic processing in response to alkaline pH signals . Similar mechanisms likely operate in Botryotinia fuckeliana, with palH/RIM21 serving as the initial sensor that triggers the adaptive response.

What are the optimal expression and purification methods for recombinant palH/RIM21?

Successful expression and purification of recombinant palH/RIM21 requires careful optimization due to its nature as an integral membrane protein. The established protocol utilizes E. coli as an expression host for the full-length protein (1-742 amino acids) fused to an N-terminal His-tag to facilitate purification . When designing expression constructs, researchers should incorporate appropriate fusion tags (His, FLAG, or HA) depending on the intended experimental applications, with a flexible linker sequence to maintain protein function . Expression conditions must be carefully optimized to balance protein yield with proper folding, typically involving lower temperatures (16-25°C) and reduced inducer concentrations to slow production and allow proper membrane insertion.

Cell lysis and protein extraction represent critical steps requiring specialized detergents suitable for membrane proteins, such as n-dodecyl-β-D-maltoside (DDM) or digitonin, which effectively solubilize membrane proteins while preserving native structure. Purification typically employs immobilized metal affinity chromatography (IMAC) leveraging the His-tag, followed by size exclusion chromatography to achieve higher purity if needed for specific applications . For functional studies, researchers must carefully consider the detergent environment throughout purification, as inappropriate detergents can disrupt protein structure and function.

Post-purification processing involves buffer exchange to remove imidazole (from IMAC) and concentration to desired levels, followed by reconstitution or stabilization. The purified protein is often provided as a lyophilized powder, which requires proper reconstitution before use . For reconstitution, brief centrifugation of the vial before opening is recommended, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol (5-50% final concentration, with 50% being standard) is crucial for long-term storage stability and to prevent freeze-thaw damage .

What experimental models and assays best evaluate palH/RIM21 function?

Multiple experimental systems can be employed to investigate different aspects of palH/RIM21 function, each with specific advantages depending on research objectives. Heterologous expression in yeast models, particularly Saccharomyces cerevisiae strains with deletions in native pH sensing components, provides a eukaryotic environment with conserved cellular machinery for functional studies . When designing such systems, fusion constructs with epitope tags (HA, FLAG) or fluorescent proteins enable detection and visualization, while maintaining appropriate promoter strength to avoid artifacts from overexpression . For localization studies, fluorescent protein fusions combined with confocal microscopy can reveal the characteristic patchy plasma membrane distribution pattern observed with homologous proteins .

Functional assays to assess pH sensing activity include reporter gene systems driven by pH-responsive promoters, which can quantitatively measure pathway activation. These systems can be combined with site-directed mutagenesis of specific palH/RIM21 domains to identify regions critical for function. Membrane potential measurements using voltage-sensitive dyes or electrophysiological techniques can directly assess the relationship between pH changes, membrane depolarization, and pathway activation, testing the hypothesis that membrane potential changes serve as the primary signal for palH/RIM21 .

For protein-protein interaction studies, co-immunoprecipitation using differentially tagged proteins (e.g., palH/RIM21-HA with potential interaction partners tagged with FLAG) has proven effective for identifying components of the pH sensing complex . More sophisticated approaches like proximity-based labeling (BioID, APEX) or fluorescence resonance energy transfer (FRET) can capture transient interactions and provide spatial information about where these interactions occur. In vitro reconstitution systems using purified components in artificial membrane environments (liposomes, nanodiscs) allow controlled manipulation of membrane properties to dissect the specific parameters sensed by palH/RIM21.

How does palH/RIM21 interact with other components of the pH sensing machinery?

Based on studies of homologous systems, palH/RIM21 likely forms a complex with multiple proteins that collectively constitute the pH sensing machinery at the plasma membrane. In Saccharomyces cerevisiae, Rim21 (the yeast homolog of palH) forms a complex with Dfg16 and Rim9, which are integral membrane proteins that co-localize with Rim21 at the plasma membrane in a characteristic patchy distribution . These proteins exhibit mutual dependency for their stability and proper localization, suggesting they function as an integrated complex rather than as independent entities . Botryotinia fuckeliana likely contains homologs of these auxiliary proteins that perform similar functions in supporting palH/RIM21.

The functional relationship between these proteins appears hierarchical, with Rim21 serving as the primary pH sensor while the others play supporting roles. When Rim21 is absent or degraded, the pH response pathway is completely suppressed, whereas loss of Dfg16 or Rim9 has less severe effects . This indicates that palH/RIM21 is likely the key sensor component in Botryotinia fuckeliana, with other proteins maintaining its levels and assisting in its plasma membrane localization rather than directly sensing pH themselves .

Upon external alkalization, these proteins undergo internalization and degradation as part of the response mechanism . This degradation appears to be a regulated process that may serve as a feedback mechanism to control the duration and intensity of the pH response. The complex also has connections to the membrane lipid environment, with alterations in lipid asymmetry affecting pathway activation . This suggests that palH/RIM21 may sense changes in membrane properties associated with pH shifts rather than directly detecting hydrogen ion concentration, and that its interactions with other proteins may be modulated by the lipid environment.

What are the critical storage and handling parameters for recombinant palH/RIM21?

Proper storage and handling of recombinant palH/RIM21 is essential for maintaining structural integrity and functional activity throughout experimental work. For long-term storage, the lyophilized powder form should be maintained at -20°C or -80°C upon receipt . This storage temperature minimizes protein degradation and preserves activity by reducing molecular motion and preventing hydrolytic reactions that could damage the protein structure. When preparing working stocks, researchers should aliquot the material to avoid repeated freeze-thaw cycles of the main stock, as such cycles can progressively damage the protein structure through ice crystal formation and concentration fluctuations during thawing.

Buffer composition plays a critical role in protein stability, with the recommended Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 providing an optimal environment . Trehalose functions as a cryoprotectant and stabilizing agent by preventing protein aggregation and maintaining hydration shells around the protein during freeze-thaw cycles. The pH value of 8.0 helps maintain protein stability by keeping the protein away from its isoelectric point, reducing aggregation potential.

For reconstituted protein, glycerol addition is essential for maintaining stability during storage. The recommended protocol involves reconstitution in deionized sterile water to 0.1-1.0 mg/mL followed by addition of glycerol to a final concentration between 5-50%, with 50% being standard practice . Glycerol prevents ice crystal formation during freezing and reduces water activity, helping preserve protein structure. Working aliquots can be stored at 4°C for up to one week, but should not be subjected to repeated temperature changes . For experiments requiring the protein in detergent-free conditions, researchers must carefully optimize the detergent removal process to prevent protein aggregation or denaturation, typically using stepwise dialysis or detergent-absorbing beads.

How can researchers verify the functional activity of purified palH/RIM21?

Verifying the functional activity of purified palH/RIM21 requires a multi-faceted approach that addresses both structural integrity and functional capability. Initial assessment typically begins with protein purity and integrity verification using SDS-PAGE, which should show a predominant band at the expected molecular weight (~82 kDa for the 742 amino acid protein plus any fusion tags) . Western blotting with antibodies against the fusion tag or the protein itself provides further confirmation of identity and integrity, while mass spectrometry can verify the complete sequence and identify any post-translational modifications or degradation products.

Structural integrity assessment using circular dichroism (CD) spectroscopy can confirm that the purified protein maintains its expected secondary structure, particularly important for the transmembrane regions that are critical for membrane anchoring and sensing function. For membrane proteins like palH/RIM21, appropriate folding in the detergent micelle or lipid environment is essential for function, making structural verification a key step in activity assessment.

Functional activity can be evaluated through several complementary approaches. Reconstitution into liposomes or nanodiscs followed by membrane potential measurements in response to pH changes can directly assess the protein's ability to respond to its presumed stimulus, as membrane depolarization appears to be a key signal detected by this protein class . Protein-protein interaction assays with known partners from the pH sensing complex can verify that the purified protein maintains its ability to form appropriate complexes. If working with a fluorescently tagged version, microscopy can confirm proper membrane localization in a heterologous expression system.

The gold standard for functional verification remains complementation assays in deletion mutants lacking the endogenous pH sensor proteins. If the recombinant palH/RIM21 restores pH responsiveness in these mutants, this provides strong evidence of functional activity in a physiologically relevant context.

What analytical techniques best characterize palH/RIM21-protein interactions?

Characterizing the interactions between palH/RIM21 and other components of the pH sensing machinery requires specialized techniques optimized for membrane proteins. Co-immunoprecipitation (Co-IP) using differentially tagged proteins has proven particularly effective for identifying stable protein interactions in the pH sensing complex . This approach typically involves expressing palH/RIM21 with one tag (such as HA) alongside potential interaction partners with different tags (such as FLAG), followed by pulldown experiments using antibodies against one tag and detection of co-precipitated proteins with antibodies against the other tag . The choice of detergent is critical in these experiments, as it must effectively solubilize the membrane proteins while preserving native interactions.

For detecting transient or weak interactions that might be disrupted during traditional Co-IP, proximity-based labeling techniques offer significant advantages. BioID, which uses a promiscuous biotin ligase fusion to label proteins in close proximity, or APEX, which generates reactive biotin species to tag nearby proteins, can capture the dynamic interactome of palH/RIM21 in its native membrane environment. These approaches are particularly valuable for membrane proteins where traditional interaction detection methods may fail due to the hydrophobic nature of the proteins and their complex membrane environment.

Microscopy-based interaction detection methods provide spatial context for protein interactions. Förster resonance energy transfer (FRET) between fluorescently-tagged proteins can detect interactions with nanometer precision, while bimolecular fluorescence complementation (BiFC) provides a visual readout of protein proximity through the reconstitution of a split fluorescent protein. These techniques allow visualization of where in the cell palH/RIM21 interacts with its partners, potentially revealing specialized membrane domains involved in pH sensing.

For studying interactions with membrane lipids, which appear relevant to palH/RIM21 function based on studies showing that lipid asymmetry affects pH sensing , techniques such as lipid binding assays, lipid strips, and liposome flotation assays can identify specific lipid preferences. These approaches can help determine whether palH/RIM21 directly interacts with certain lipid species or if it responds to physical properties of the membrane influenced by lipid composition.

How does palH/RIM21 function compare across different fungal species?

Comparative analysis of pH sensing systems across fungal species reveals both conserved functional principles and species-specific adaptations. The Botryotinia fuckeliana palH/RIM21 protein belongs to a family of fungal pH sensors that includes PalH in Aspergillus nidulans and Rim21 in Saccharomyces cerevisiae . Despite moderate sequence homology (Rim21 in yeast shares approximately 27% sequence identity with PalH in A. nidulans), these proteins share core functional features suggesting evolutionary conservation of the pH sensing mechanism . All these proteins localize to the plasma membrane in a characteristic patchy distribution pattern and function as primary sensors for ambient pH changes, indicating functional conservation despite sequence divergence .

The organizational structure of the pH sensing complex shows consistent patterns across species. In S. cerevisiae, Rim21 forms a complex with Dfg16 and Rim9, while in A. nidulans, PalH requires another membrane protein, PalI (the homolog of Rim9), for proper plasma membrane localization . This organizational similarity suggests that palH/RIM21 in Botryotinia fuckeliana likely operates within a similar multiprotein complex, though the specific components may show species-specific variations reflecting different ecological niches.

The downstream signaling mechanisms also demonstrate conservation, with all these pH sensor systems ultimately regulating transcription factors that control pH-responsive gene expression—Rim101 in yeast and PacC in A. nidulans . This conservation extends to the mechanism of transcription factor activation, which involves proteolytic processing in response to the pH signal. In A. nidulans, this occurs through a "signaling protease box," a 24-residue highly conserved region in PacC that undergoes pH-regulated cleavage . Similar mechanisms likely operate in the Botryotinia fuckeliana system, with palH/RIM21 initiating the signaling cascade that leads to activation of pH-responsive transcription.

What structural and functional domains are conserved in fungal pH sensors?

Structural and functional domain analysis of fungal pH sensors reveals several highly conserved elements that are likely critical for sensing function. The transmembrane domains represent the most obvious conserved structural features, with multiple membrane-spanning regions that anchor the protein to the plasma membrane . These domains likely play dual roles in localization and sensing function, as they position the protein to detect changes in membrane properties associated with pH shifts and may undergo conformational changes in response to membrane potential alterations.

The regions involved in protein-protein interactions show functional conservation, if not always strict sequence conservation. These domains enable the formation of multiprotein complexes at the plasma membrane that are essential for pH sensing, as seen in the interactions between Rim21, Dfg16, and Rim9 in yeast, and similar complexes in other fungi . The conservation of these interaction capabilities suggests that the assembly of a sensing complex is a fundamental requirement for function across fungal species.

Signaling domains that transduce the pH signal from the membrane to downstream components demonstrate functional conservation across species. While the exact sequence may vary, the ability to initiate a signaling cascade in response to pH-induced membrane changes appears to be a universal feature of these sensors. Similarly, domains involved in protein trafficking and regulation show conservation, as evidenced by the common pattern of protein internalization and degradation in response to alkaline pH across different fungal systems .

Perhaps most intriguingly, the signal detection mechanism itself appears conserved, with plasma membrane depolarization serving as a key trigger for the pH response pathway. Research indicates that these pH sensor proteins can respond to membrane potential changes even without external alkalinization, suggesting a conserved mechanism for detecting membrane electrical properties rather than direct pH sensing . This conservation of sensing mechanism implies strong evolutionary pressure to maintain this particular mode of environmental pH detection.

What are the unresolved questions in palH/RIM21 research?

Despite significant advances in understanding fungal pH sensing mechanisms, several critical questions about palH/RIM21 remain unresolved. The precise molecular mechanism by which palH/RIM21 detects pH-induced changes in membrane properties has not been fully elucidated. While evidence suggests plasma membrane depolarization serves as a key signal , the specific structural changes or conformational shifts that allow the protein to sense these electrical changes remain unclear. Determining whether the protein directly interacts with protons/hydroxide ions or exclusively responds to secondary effects like membrane potential changes would significantly advance our understanding of pH sensing mechanisms.

The three-dimensional structure of palH/RIM21 has not been resolved, representing a major knowledge gap. Structural studies are challenging due to the integral membrane nature of the protein, but would provide crucial insights into how specific domains contribute to sensing, signal transduction, and protein interactions. Advanced structural biology techniques such as cryo-electron microscopy or X-ray crystallography optimized for membrane proteins could potentially overcome these challenges.

The complete composition and stoichiometry of the pH sensing complex in Botryotinia fuckeliana remains to be fully characterized. While studies in yeast have identified Rim21, Dfg16, and Rim9 as complex components , the exact arrangement and potential additional components in the B. fuckeliana system require further investigation. Proteomics approaches combined with interaction studies could identify the complete interactome of palH/RIM21 under different pH conditions.

Regulatory mechanisms controlling palH/RIM21 expression, localization, and degradation under different environmental conditions represent another area requiring further research. Studies in yeast have shown that Rim21 undergoes internalization and degradation upon external alkalization , but the molecular details of this process and whether similar mechanisms exist in B. fuckeliana need clarification. Additionally, potential cross-talk between the pH response pathway and other environmental sensing pathways (e.g., nutrient sensing, stress response) remains poorly understood but could be critical for understanding how fungi integrate multiple environmental signals.

How does palH/RIM21 research contribute to applied fungal biology?

Research on palH/RIM21 has significant implications for both fundamental understanding of fungal biology and various applied fields. In agricultural contexts, understanding pH sensing in Botryotinia fuckeliana (Botrytis cinerea) has direct relevance to plant pathology, as this fungus is a major plant pathogen causing gray mold disease across diverse crops . The ability to sense and adapt to varying pH environments is critical for successful infection, as pathogens encounter different pH conditions in different plant tissues and at different stages of infection. Knowledge of pH sensing mechanisms could potentially lead to novel control strategies targeting this critical environmental adaptation pathway.

From an evolutionary biology perspective, comparative studies of pH sensing mechanisms across fungal species provide insights into how environmental sensing systems evolve and adapt. The identification of both conserved elements and species-specific adaptations in pH sensing proteins like palH/RIM21 illuminates how fundamental cellular processes are maintained while allowing adaptation to specific ecological niches . The finding that Botryotinia fuckeliana contains two distinct genetic populations (transposa and vacuma) with different genetic characteristics raises interesting questions about whether these populations might show differences in pH sensing capabilities or environmental adaptation strategies.

For biotechnology applications, understanding fungal pH adaptation could improve industrial processes involving fungal production systems. Many industrial fermentations and enzyme production processes using fungi are affected by environmental pH, and insights from palH/RIM21 research could potentially be applied to optimize these processes. Additionally, the molecular tools and methodologies developed for studying palH/RIM21 and related proteins contribute to the broader toolbox for investigating membrane proteins and environmental sensing mechanisms in diverse organisms.

In the context of medical mycology, while Botryotinia fuckeliana is not a human pathogen, the conservation of pH sensing mechanisms across fungi suggests that insights from this system may have relevance to understanding pH adaptation in medically important fungi. Many fungal pathogens must adapt to the varying pH environments encountered during infection, and comparative studies could reveal common principles and potential intervention points.

What are the key comparative features of fungal pH sensor proteins?

The following table summarizes the comparative features of pH sensor proteins across different fungal species, highlighting both conserved elements and species-specific adaptations:

FeatureBotryotinia fuckeliana palH/RIM21Saccharomyces cerevisiae Rim21Aspergillus nidulans PalH
Protein Length742 amino acids Variable (species-dependent)Variable (species-dependent)
Primary FunctionpH sensing (predicted) pH sensing pH sensing
Cellular LocalizationPlasma membrane (predicted)Plasma membrane, patchy distribution Plasma membrane
Auxiliary ProteinsPredicted homologs of Dfg16 and Rim9Dfg16 and Rim9 PalI (Rim9 homolog)
Response to AlkalizationPredicted internalization and degradationUndergoes internalization and degradation Similar response mechanism predicted
Sensing MechanismLikely plasma membrane depolarizationPlasma membrane depolarization Similar mechanism predicted
Downstream SignalingActivates pH-responsive transcription factorsActivates Rim101 pathway Activates PacC pathway
Sequence Homology100% (reference)~27% with A. nidulans PalH ~27% with S. cerevisiae Rim21

This comparative analysis reveals the functional conservation of pH sensing mechanisms across distantly related fungal species despite moderate sequence homology. The consistent localization to the plasma membrane in a patchy distribution pattern, dependency on auxiliary proteins for proper localization and function, similar response mechanisms to alkaline pH, and conserved downstream signaling pathways all suggest strong evolutionary pressure to maintain this environmental sensing system . These similarities enable researchers to apply findings from well-studied systems like S. cerevisiae and A. nidulans to develop hypotheses about the less characterized Botryotinia fuckeliana pH sensing system.

The identification of plasma membrane depolarization as a key signal across different fungal pH sensing systems points to a conserved sensing mechanism rather than direct detection of hydrogen ion concentration . This insight has important implications for experimental design when studying palH/RIM21, suggesting that membrane potential measurements could provide valuable information about sensor activation. The conservation of auxiliary proteins across species indicates that proper complex formation is essential for pH sensing function, highlighting the importance of studying protein-protein interactions in addition to the properties of palH/RIM21 itself.

What are the standard expression and purification parameters for recombinant palH/RIM21?

The following table outlines the critical parameters for successful expression and purification of recombinant palH/RIM21 protein based on established protocols:

ParameterRecommended ConditionsCritical Considerations
Expression HostE. coli May require specialized strains for membrane proteins
Expression ConstructFull length (1-742 aa) with N-terminal His-tag Inclusion of flexible linker sequence recommended
Growth MediumStandard rich medium (e.g., LB, 2xYT)Supplementation with glucose may help reduce leaky expression
Induction ConditionsLower temperatures (16-25°C) recommendedSlower expression often improves membrane protein folding
Cell LysisDetergent-based methods suitable for membrane proteinsCareful selection of detergent critical for maintaining structure
Purification MethodIMAC utilizing His-tag Consider additional purification steps for higher purity
Purity Assessment>90% by SDS-PAGE Verify single band at expected molecular weight
Final FormulationLyophilized powder Maintains stability during shipping and storage
Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0 Trehalose acts as cryoprotectant
Reconstitution0.1-1.0 mg/mL in deionized sterile water Brief centrifugation of vial recommended before opening
Storage Recommendations-20°C/-80°C for stock; 4°C for working aliquots (up to one week) Aliquoting essential to avoid freeze-thaw cycles
StabilizationAddition of 5-50% glycerol (50% standard) Prevents freezing damage and maintains hydration

These parameters provide a starting point for researchers working with recombinant palH/RIM21, though optimization may be necessary for specific experimental applications. The integral membrane nature of palH/RIM21 presents particular challenges for expression and purification, requiring careful attention to maintaining protein structure throughout the process. The use of appropriate detergents during extraction and purification is especially critical, as inappropriate detergent selection can lead to protein denaturation or aggregation .

Post-purification handling requires special consideration due to the protein's sensitivity to freeze-thaw cycles. The recommended approach of reconstituting the lyophilized protein and adding glycerol as a cryoprotectant before aliquoting and storage helps maintain structural integrity and functional activity . The stability of reconstituted protein at 4°C is limited to approximately one week, emphasizing the importance of proper planning for experimental work . For long-term storage, maintaining aliquots at -20°C or preferably -80°C provides optimal stability, particularly when the protein is stored in buffer containing Trehalose and glycerol as protective agents .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.