Recombinant Botryotinia fuckeliana Protein get1 (get1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
get1; BC1G_04578; Protein get1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)
Target Names
get1
Target Protein Sequence
MPSLLFTCFLVQLLIHLVNTFGADAINNLLWNLYNMFPTPTSQSAGEQKKLKREFMKVRH EMNATSSQDEFAKWAKLRRQHDKLFDQLEKSKSSLDSTKSTFDSSVSTLRWLGTNGLRML LQFWFSKQAMFWLPKGWFPYYAEWLLSFPRAPLGSISIQAWTLACAAVILLVSDALVAVV ALALGTQTGAKAKKMEEPMKAGGQGTEKPGKKEL
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble Get3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Botryotinia fuckeliana Protein get1 and what is its biological function?

Protein get1 (Guided entry of tail-anchored proteins 1) is a membrane protein found in Botryotinia fuckeliana, also known as Botrytis cinerea or Noble rot fungus. This protein plays a critical role in the insertion of tail-anchored proteins into cellular membranes. In its native context, get1 functions as part of the GET complex (Guided Entry of Tail-anchored proteins), which facilitates the post-translational insertion of tail-anchored membrane proteins into the endoplasmic reticulum . The protein contains transmembrane domains and exhibits specific membrane topology that enables its function in protein trafficking.

What is the relationship between Botryotinia fuckeliana and Botrytis cinerea?

Botryotinia fuckeliana is the teleomorph (sexual form) of Botrytis cinerea, which is the anamorph (asexual form). They represent different stages in the life cycle of the same fungal organism . B. cinerea is a haploid, filamentous, heterothallic ascomycete that contains significant intrapopulation genetic variation . In scientific literature, both names are used interchangeably, though Botrytis cinerea is more commonly used when discussing the pathogenic aspects of the fungus, while Botryotinia fuckeliana is often referenced in taxonomic and genetic studies .

What expression systems are commonly used for recombinant get1 production?

The most common expression system for recombinant Botryotinia fuckeliana Protein get1 is Escherichia coli. According to available product information, recombinant get1 is typically produced with an N-terminal His tag to facilitate purification . For expression, the full-length protein (amino acids 1-214) is cloned into appropriate expression vectors under control of strong promoters such as T7.

Similar to other recombinant proteins from B. fuckeliana, such as Ras-like protein (ras1), the expression is optimized for high yield and purity (>85-90%) . While E. coli is the predominant system, other fungal proteins from B. fuckeliana have been successfully expressed in Pichia pastoris, suggesting this yeast might be an alternative expression system for get1 when post-translational modifications are required .

What purification methods yield the highest purity and activity of recombinant get1?

Purification of His-tagged recombinant get1 typically follows these steps:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture the His-tagged protein

  • Intermediate Purification: Size exclusion chromatography to separate target protein from aggregates and impurities

  • Polishing: Ion exchange chromatography if higher purity is required

The typical purity achieved is greater than 90% as determined by SDS-PAGE . For maintaining functional activity, it's important to:

  • Purify in the presence of mild detergents (e.g., 0.1% DDM or 0.5% CHAPS) since get1 is a membrane protein

  • Include stabilizing agents like glycerol (typically 5-50%) in buffers

  • Avoid repeated freeze-thaw cycles

  • Maintain appropriate pH (typically pH 7.5-8.0) and ionic strength

What are the optimal storage conditions for recombinant get1?

Recombinant get1 should be stored following these guidelines:

Storage FormTemperatureDurationBuffer Components
Lyophilized powder-20°C to -80°C12 monthsN/A
Reconstituted (stock)-20°C to -80°C6 monthsTris-based buffer with 50% glycerol
Working aliquots4°CUp to 1 weekDepends on experiment

Repeated freezing and thawing should be avoided as it may lead to protein degradation and loss of activity . For extended storage, conservation at -80°C is recommended over -20°C.

What is the recommended protocol for reconstitution of lyophilized get1?

For optimal reconstitution of lyophilized recombinant get1:

  • Briefly centrifuge the vial before opening to bring all material to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Gently mix until completely dissolved; avoid vigorous shaking or vortexing

  • Aliquot into smaller volumes to minimize freeze-thaw cycles

  • Flash freeze aliquots in liquid nitrogen before storing at -20°C/-80°C

The standard storage buffer consists of a Tris-based buffer with 50% glycerol, optimized for this specific protein .

How can I verify the purity and integrity of recombinant get1?

Multiple analytical methods can be employed to verify the purity and integrity of recombinant get1:

  • SDS-PAGE analysis: Should show a predominant band at approximately 24 kDa (size may vary with tags)

  • Western blot: Using anti-His antibody (for His-tagged protein) or specific anti-get1 antibodies

  • Mass spectrometry: For accurate molecular weight determination and sequence verification

  • Size exclusion chromatography: To analyze aggregation state and homogeneity

  • Dynamic light scattering: To assess size distribution and potential aggregation

Functional assays can include membrane integration assays or interaction studies with known binding partners from the GET pathway.

What functional assays can be used to study get1 activity?

Several experimental approaches can be used to study get1 function:

  • Membrane integration assays: Reconstitution of get1 into liposomes and measurement of tail-anchored protein insertion

  • Protein-protein interaction studies:

    • Pull-down assays with other GET complex proteins

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Crosslinking studies to capture transient interactions

  • Structural studies:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Nuclear magnetic resonance (NMR) for structural determination in solution

    • X-ray crystallography for high-resolution structure (challenging for membrane proteins)

  • Cellular assays:

    • Complementation studies in yeast get1 mutants

    • Localization studies using fluorescently tagged get1

How can genetic manipulation of get1 be used to study its function in Botryotinia fuckeliana?

Genetic manipulation approaches for studying get1 function include:

  • Gene deletion/knockout: Using homologous recombination techniques to replace the get1 gene with a selection marker. This approach has been successfully used for other genes in B. fuckeliana as described in the literature .

  • RNA interference (RNAi): For knockdown studies when complete deletion is lethal.

  • Site-directed mutagenesis: To introduce specific mutations and study structure-function relationships.

  • Gene replacement with tagged versions: Introducing fluorescently tagged versions for localization studies.

Based on techniques used for other B. fuckeliana genes, the general protocol would involve:

  • Amplification of upstream and downstream flanking sequences of get1

  • Fusion with a selection marker (e.g., hygromycin resistance gene)

  • Transformation into protoplasts

  • Screening of transformants by PCR and confirmation by Southern blotting

What is the role of get1 in the context of B. fuckeliana pathogenicity?

While direct evidence linking get1 to B. fuckeliana pathogenicity is not explicitly mentioned in the search results, we can consider several hypotheses based on its function:

  • As a component of the GET complex, get1 may influence the proper localization of virulence factors that are tail-anchored membrane proteins.

  • Membrane protein trafficking is essential for secretion of hydrolytic enzymes and effectors necessary for plant infection and colonization, as evidenced by studies on other B. fuckeliana proteins like rhamnogalacturonan hydrolase .

  • The potential connection to peroxisome biogenesis (analogous to the role of related proteins in yeast) could impact fatty acid metabolism and oxidative stress responses, which are important for pathogenicity .

Research approaches to investigate this connection could include:

  • Phenotypic characterization of get1 mutants for pathogenicity traits

  • Identification of tail-anchored proteins dependent on get1 for proper localization

  • Comparative transcriptomics and proteomics between wild-type and get1 mutants during infection

How does get1 contribute to membrane protein homeostasis in B. fuckeliana?

Based on knowledge of the GET pathway in other organisms, get1 likely contributes to membrane protein homeostasis through:

  • Tail-anchored protein insertion: Facilitating the post-translational insertion of tail-anchored proteins into the ER membrane.

  • Maintenance of ER morphology: GET complex components often influence ER structure.

  • Protein quality control: Preventing aggregation of hydrophobic tail-anchored proteins in the cytosol.

  • Stress response regulation: Ensuring proper localization of stress response proteins during environmental challenges.

Experimental approaches to study these functions could include:

  • Proteomic identification of get1-dependent tail-anchored proteins

  • ER morphology analysis in get1 mutants using ER-specific markers

  • Investigation of unfolded protein response activation in get1-deficient cells

  • Stress tolerance assays under various conditions (oxidative, osmotic, temperature)

What challenges might researchers encounter when working with recombinant get1?

Working with recombinant get1 presents several challenges:

  • Membrane protein solubility: As a membrane protein, get1 may have solubility issues that require optimization of detergents or lipid environments.

  • Proper folding: Ensuring correct folding during recombinant expression, especially of transmembrane domains.

  • Functional reconstitution: Developing assays that accurately assess functional activity outside the native membrane environment.

  • Stability during storage: Preventing aggregation and maintaining functionality during storage and freeze-thaw cycles.

  • Interaction studies: Capturing potentially transient or weak interactions with other GET pathway components.

Solutions to these challenges include:

  • Screening multiple detergents for optimal solubilization

  • Using membrane mimetics like nanodiscs or liposomes for functional studies

  • Optimizing buffer compositions with stabilizers like glycerol

  • Employing multiple complementary approaches for interaction studies

How can researchers integrate get1 studies with broader investigation of protein trafficking in B. fuckeliana?

To integrate get1 studies with broader protein trafficking research:

  • Systems biology approach: Combine proteomics, transcriptomics, and interactomics to map the entire GET pathway and related trafficking networks in B. fuckeliana.

  • Comparative genomics: Analyze get1 and other trafficking components across fungal species to identify conserved and divergent features .

  • Multi-protein complex reconstitution: Reconstitute the entire GET complex to study its function holistically.

  • In vivo imaging: Use fluorescently tagged trafficking components to visualize protein movement in living cells.

  • Genetic interaction screens: Perform synthetic genetic array analysis to identify functional connections between get1 and other cellular processes.

This integrated approach would provide insights not only into get1 function but also into how protein trafficking contributes to B. fuckeliana biology and pathogenicity.

What emerging technologies might advance our understanding of get1 function?

Several cutting-edge technologies could significantly advance get1 research:

  • Cryo-electron microscopy: For high-resolution structural studies of get1 alone or in complex with other GET components.

  • Proximity labeling techniques (BioID, APEX): To identify the in vivo interactome of get1 in native membranes.

  • Single-molecule techniques: To observe get1-mediated tail-anchored protein insertion in real-time.

  • CRISPR-Cas9 genome editing: For precise genetic manipulation of get1 and related genes.

  • Microfluidics and lab-on-chip approaches: For high-throughput functional assays.

  • Computational approaches: Including molecular dynamics simulations to understand get1 dynamics in membranes and AI-based prediction of protein-protein interactions.

These technologies would provide unprecedented insights into the molecular mechanisms of get1 function and its role in the broader context of membrane protein biogenesis.

How might get1 function relate to stress responses and environmental adaptation in B. fuckeliana?

The potential connections between get1 function and stress responses include:

  • Membrane remodeling during stress: The GET pathway may be crucial for adjusting membrane composition and protein content during environmental stress.

  • Oxidative stress handling: Proper localization of antioxidant enzymes and redox-regulating proteins might depend on functional get1.

  • Host invasion processes: Stress adaptation during plant colonization could involve get1-dependent trafficking of specialized proteins.

  • Developmental transitions: Changes in protein trafficking during different life cycle stages (e.g., conidiation, sclerotial formation) might involve get1 regulation.

Future research could explore:

  • Transcriptional and post-translational regulation of get1 under various stress conditions

  • Identification of stress-specific tail-anchored proteins dependent on get1

  • Phenotypic characterization of get1 mutants under various environmental challenges

  • Comparative analysis of GET pathway components across fungal species with different ecological niches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.