Recombinant Bovine 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Mechanism

AGPAT4’s primary role involves:

  • PA Synthesis: Converting LPA to PA, a precursor for glycerophospholipids and triacylglycerols (TAGs) .

  • Membrane Dynamics: PA’s cone-shaped structure facilitates membrane curvature, aiding Golgi complex fission and mitochondrial membrane remodeling .

  • Metabolic Regulation: Modulates lipid storage and lipolysis in adipose tissue .

In bovine systems, AGPAT4 exhibits substrate specificity for LPA and oleoyl-CoA, with no activity toward lysophospholipids like lysophosphatidylcholine .

Adipose Tissue Metabolism

  • AGPAT4 Knockout Mice: Showed 40% larger epididymal white adipose tissue (WAT) due to reduced lipolysis (29% lower TAG hydrolase activity) and decreased ATGL/HSL phosphorylation .

  • Depot-Specific Effects: Compensatory upregulation of other AGPAT isoforms (Agpat1, 2, 3, 5) occurred in perirenal WAT but not epididymal WAT, highlighting metabolic heterogeneity .

Cellular and Organellar Roles

  • Golgi Membrane Fission: AGPAT4 interacts with BARS (Brefeldin A ADP-Ribosylated Substrate) to generate PA, enabling membrane fission at the trans-Golgi network .

  • Mitochondrial Function: PA synthesis at mitochondrial outer membranes influences fusion/fission dynamics .

Applications in Research Tools

Recombinant bovine AGPAT4 is widely used in lipid metabolism studies:

Detection Kits

Kit TypeDetection RangeSensitivitySample Types
Bovine ELISA Kit10–250 ng/mL1.0 ng/mLSerum, plasma, tissue homogenates

Source:

Antibodies and Proteins

  • Antibodies: Rabbit-derived anti-AGPAT4 antibodies for Western blot (WB) and immunohistochemistry (IHC) .

  • Recombinant Proteins: Available in multiple systems (e.g., E. coli, mammalian cells) with biotinylation options .

Comparative Insights Across Species

While bovine AGPAT4 shares 87.8% amino acid similarity with humans , functional studies in mice reveal conserved roles in lipid storage and membrane biology . Buffalo mammary epithelial cell studies further link AGPAT4 to milk fat synthesis by regulating unsaturated fatty acid (UFA) incorporation into TAGs .

Clinical and Agricultural Implications

  • Cancer Research: AGPAT4 silencing in colorectal cancer cells reduces tumor growth by altering lysophosphatidic acid (LPA)-mediated macrophage polarization .

  • Dairy Science: AGPAT4 overexpression enhances TAG synthesis in mammary cells, suggesting potential for improving milk fat quality .

Future Directions

  • Therapeutic Targeting: AGPAT4 inhibitors may address metabolic disorders or cancers reliant on PA signaling .

  • Agricultural Biotechnology: Engineering AGPAT4 expression could optimize lipid profiles in livestock .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
AGPAT4; 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-acylglycerol-3-phosphate O-acyltransferase 4; 1-AGP acyltransferase 4; 1-AGPAT 4; Lysophosphatidic acid acyltransferase delta; LPAAT-delta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MDLVALLKSHFLCHLIFCYVFIVSGLIINTIQLCTLLLWPVNKQLFRKINCRLSYCVSSQ LVMLLEWWSGTECVIYTDPRAYPKYGKENAIVVLNHKFEIDFLCGWSLAERFGVLGGSKV LAKKELAYVPIIGWMWYFTEMVFCTRKWEQDRKTVSESLLHLRDYPEKYFFLIHCEGTRF TEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAVTVRSLRNVVSAVYDCTLNFRNNENPTL LGVLNGKKYHADLYVRRIPLEEVPEEEDKCAAWLHKLYQEKDAFQEEYSRTGTFPETPVV PPRRPWTLVNWLFWASMLLYPFFRFVINMVSSGSSLTLASFVLVFFVASMGVRWMIGVTE IDKGSAYGNMDSKQKHSD
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) to 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by adding an acyl moiety to the sn-2 position of the glycerol backbone. It exhibits high specificity for polyunsaturated fatty acyl-CoAs, particularly docosahexaenoyl-CoA (22:6-CoA, DHA-CoA).
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is AGPAT4 and what is its primary function?

AGPAT4, also known as 1-AGPAT4 or LPAAT-delta, is an integral membrane protein that belongs to the 1-acylglycerol-3-phosphate O-acyltransferase family. Its primary function is to convert lysophosphatidic acid (LPA) to phosphatidic acid (PA), representing the second step in de novo phospholipid biosynthesis. AGPAT4 functions catalytically as a true AGPAT/LPAAT in vitro, utilizing LPA as its major lysophospholipid acyl-acceptor . Unlike some other acyltransferases with broader substrate specificities, AGPAT4 demonstrates specificity for LPA, confirming its classification as a genuine lysophosphatidic acid acyltransferase .

Where is AGPAT4 primarily expressed?

AGPAT4 shows tissue-specific expression patterns with particularly high levels in the brain. It has been immunodetected in both cortical neurons and glial cells derived from the developing mouse brain . Immunohistochemistry on mixed cultures of primary cortical cells derived from E18.5 embryonic mice revealed that AGPAT4 exhibits a diffuse, punctate staining pattern and co-localizes with cells positive for neuronal markers (NESTIN and Nissl stain) as well as with cells expressing the glial marker GFAP . This distribution suggests important roles in both neuronal and glial cell function within the central nervous system.

How does AGPAT4 expression change during development?

AGPAT4 expression varies significantly throughout embryonic development. RT-qPCR analysis of mouse embryos at different developmental stages revealed that Agpat4 mRNA is differentially expressed at three timepoints during murine embryogenesis . Specifically, Agpat4 was upregulated 3.7-fold at developmental day E14.5 compared to day E10.5, followed by a dramatic decrease to only 4% of day E14.5 levels by day E18.5 (immediately prior to birth) . This dynamic expression pattern suggests AGPAT4 may play important developmental roles, particularly during mid-embryogenesis when cellular and organellar growth is rapid, supporting organogenesis including the development of the central nervous system.

What phospholipids are specifically affected by AGPAT4 activity?

Despite functioning as a lysophosphatidic acid acyltransferase that produces phosphatidic acid, AGPAT4 appears to specifically support the production of certain downstream phospholipids. Studies have demonstrated that AGPAT4 regulates brain levels of phosphatidylinositol (PI), phosphatidylcholine (PC), and phosphatidylethanolamine (PE) . In vitro overexpression studies showed that cellular phosphatidylinositol content increased by 72% in cells overexpressing AGPAT4 relative to control cells . Complementarily, Agpat4 knockout mice exhibited a significant 52% decrease in brain PI content, a 39% decrease in PC, and a 32% decrease in PE relative to wild-type mice . These findings suggest that AGPAT4-derived phosphatidic acid forms a functionally distinct substrate pool for the synthesis of these specific downstream phospholipid species.

What is the molecular mechanism through which AGPAT4 regulates specific phospholipid pools?

The mechanism by which AGPAT4 specifically influences PI, PC, and PE levels while functioning as a LPA acyltransferase appears to involve the generation of a distinct pool of phosphatidic acid. Research suggests that AGPAT4-derived PA forms a functionally distinct substrate pool for the synthesis of these specific downstream phospholipid species . This functional compartmentalization of PA may explain the apparent redundancy of Agpat/Lpaat isoform expression in vivo. While AGPAT4 catalytically functions as a true AGPAT/LPAAT, utilizing LPA as its acyl-acceptor, the resultant PA appears to be channeled preferentially toward the synthesis of PI, PC, and PE, rather than other phospholipids. This substrate channeling may be facilitated by the subcellular localization of AGPAT4 to mitochondria or by specific protein-protein interactions that direct its products to particular biosynthetic pathways .

What is known about AGPAT4 splice variants and their functional significance?

Research has identified multiple splice variants of Agpat4 (designated X1, X2, and X3) that are endogenously synthesized in various murine tissues . In vitro studies have investigated the potential functional interactions between these variants, particularly focusing on a truncated AGPAT4 isoform. While expression of the truncated protein variant did not significantly modulate the reference AGPAT4 protein activity in vitro, evidence suggests that truncated AGPAT4 protein levels may be modulated by the co-expression of reference AGPAT4 protein . This finding points to potential regulatory mechanisms involving alternative splicing and protein-protein interactions that may influence AGPAT4 function in vivo, though the physiological significance of these interactions requires further investigation.

What techniques are used to assess AGPAT4 expression in tissues?

Multiple complementary approaches can be employed to assess AGPAT4 expression:

  • Quantitative PCR (qPCR): For measuring Agpat4 mRNA expression, researchers have successfully used Taqman gene expression assays (e.g., Mm00509777_m1 for Agpat4) with expression levels normalized to housekeeping genes such as 18S (Mm04277571_s1) . The ΔΔCt method is commonly used for quantification.

  • Immunohistochemistry: For cellular localization, immunohistochemistry can be performed on primary cell cultures or tissue sections. Primary cortical cells can be grown on coverslips in Neurobasal® medium with B27 supplementation to promote neuronal differentiation. AGPAT4 can be visualized using specific antibodies, while cell types can be identified using markers such as NESTIN or Nissl stain for neurons and GFAP for glial cells .

  • Western Blotting: For protein expression analysis, immunoblotting with AGPAT4-specific antibodies can be used to detect both the reference and variant protein forms. This technique is particularly useful for comparing relative protein levels between different tissues or experimental conditions .

How can researchers generate and validate AGPAT4-deficient animal models?

The generation and validation of AGPAT4-deficient animal models typically involve:

  • Gene Targeting: Knockout mice can be generated using homologous recombination to disrupt the Agpat4 gene or using CRISPR/Cas9 technology for targeted gene editing.

  • Genotyping: PCR-based genotyping using primers specific to the wild-type allele and the targeted/modified allele can confirm the genetic status of the animals.

  • Expression Validation: RT-qPCR and Western blotting should be performed to confirm the absence of Agpat4 mRNA and protein in knockout tissues.

  • Functional Validation: Enzymatic activity assays using tissue homogenates or isolated cellular fractions can confirm the loss of AGPAT enzymatic activity.

  • Phenotypic Characterization: Comprehensive phenotyping should include behavioral tests (e.g., Morris Water Maze for cognitive assessment), biochemical analyses of phospholipid composition, and histological examination of relevant tissues .

What methods are appropriate for analyzing phospholipid changes in AGPAT4 research?

Several analytical approaches can be used to assess phospholipid changes:

  • Lipid Extraction: The Folch method or Bligh and Dyer method can be used to extract total lipids from tissues or cells.

  • Thin-Layer Chromatography (TLC): TLC can separate different phospholipid classes for quantification.

  • High-Performance Liquid Chromatography (HPLC): HPLC coupled with evaporative light scattering detection or UV detection can provide quantitative analysis of phospholipid classes.

  • Mass Spectrometry: Liquid chromatography-mass spectrometry (LC-MS) or gas chromatography-mass spectrometry (GC-MS) offers detailed analysis of phospholipid molecular species, including headgroup and fatty acid composition.

  • Phosphorus Assay: Total phospholipid content can be determined by measuring phosphorus content after acid digestion.

For specific analysis of PI, PC, and PE levels affected by AGPAT4, researchers should include appropriate internal standards for each phospholipid class to ensure accurate quantification .

How can the enzymatic activity of recombinant AGPAT4 be measured in vitro?

The enzymatic activity of recombinant AGPAT4 can be assessed using the following approach:

  • Protein Expression Systems: Recombinant AGPAT4 can be expressed in systems such as Sf9 insect cells, E. coli, or mammalian cell lines. For bovine AGPAT4, specific expression vectors containing the bovine sequence should be constructed .

  • Activity Assay: The classic assay involves incubating the enzyme with lysophosphatidic acid (LPA) as the acyl acceptor and acyl-CoA as the acyl donor, followed by measurement of phosphatidic acid (PA) formation.

  • Substrate Specificity Testing: Various lyso-phospholipid substrates (e.g., LPA, LPC, LPE) and acyl-CoA donors with different fatty acid chain lengths and saturations can be tested to determine substrate preferences.

  • Kinetic Analysis: Varying substrate concentrations can be used to determine Km and Vmax values for AGPAT4.

  • Inhibitor Studies: Various inhibitors can be tested to characterize the enzyme's sensitivity and identify potential regulatory mechanisms.

The reaction products can be analyzed by TLC, HPLC, or mass spectrometry. Radiolabeled substrates (e.g., [14C]-labeled acyl-CoA) can also be used for increased sensitivity in detecting reaction products .

What are the implications of AGPAT4 function for neurological disorders?

Given AGPAT4's significant role in regulating brain phospholipid composition and its impact on cognitive function, it may have important implications for neurological disorders. The observed impairment in spatial learning and memory in Agpat4 knockout mice suggests potential relevance to cognitive disorders . Phospholipids regulated by AGPAT4, including phosphatidylinositol (PI), are critical for cellular signaling pathways in the brain, while phosphatidylcholine (PC) and phosphatidylethanolamine (PE) are major components of neuronal membranes affecting their fluidity and function. Alterations in these phospholipids have been associated with various neurological conditions, including Alzheimer's disease, Parkinson's disease, and certain forms of epilepsy. Research into AGPAT4's specific contributions to neuronal membrane composition and function could provide insights into the pathophysiology of these disorders and potentially identify new therapeutic targets.

How can understanding species differences in AGPAT4 structure and function inform translational research?

Comparative analysis of AGPAT4 across species, including recombinant bovine AGPAT4, can provide valuable insights for translational research. While companies offer recombinant AGPAT4 proteins from various species including human, rat, mouse, cynomolgus/rhesus macaque, feline, canine, bovine, and equine , few studies have systematically compared their biochemical properties and in vivo functions. Understanding species-specific differences in AGPAT4 structure, substrate preference, regulation, and tissue expression patterns can inform the selection of appropriate animal models for studying human diseases. Additionally, species differences might reveal evolutionary adaptations that provide insights into the enzyme's fundamental biological roles. For researchers using bovine AGPAT4 as a model, it's important to establish how its properties compare to the human ortholog before extrapolating findings to human health applications.

What potential exists for targeting AGPAT4 in therapeutic development?

Given AGPAT4's specific roles in phospholipid metabolism and associated physiological functions, it represents a potential therapeutic target for various conditions:

  • Neurological disorders: Given its role in brain phospholipid composition and cognitive function, modulating AGPAT4 activity might be relevant for conditions involving cognitive impairment.

  • Metabolic disorders: Since AGPAT4 affects adipose tissue biology , it might be implicated in lipid storage disorders or obesity-related conditions.

  • Muscular disorders: The reported effects on skeletal muscle fiber type and force contractility suggest potential relevance to muscle-related pathologies.

Developing specific modulators of AGPAT4 activity would require detailed understanding of its structure, catalytic mechanism, and regulation. High-throughput screening assays could be established using recombinant bovine or human AGPAT4 to identify potential inhibitors or activators. Additionally, gene therapy approaches targeting AGPAT4 expression might be considered for conditions where its activity is pathologically altered.

What comparative data is available on recombinant AGPAT4 from different species?

The following table summarizes commercially available recombinant AGPAT4 proteins from various species for research purposes:

SpeciesProduct AvailabilityCatalog NumberSize OptionsApplications
HumanAvailableGM-Tg-hg-IP0305-Ag-11mg/10mg/100mg/≥100mgCell culture, in vitro study, in vivo study, benchmark, drug discovery
RatAvailableGM-Tg-rg-IP0305-Ag-11mg/10mg/100mg/≥100mgCell culture, in vitro study, in vivo study, benchmark, drug discovery
MouseAvailableGM-Tg-mg-IP0305-Ag-11mg/10mg/100mg/≥100mgCell culture, in vitro study, in vivo study, benchmark, drug discovery
Cynomolgus/Rhesus macaqueAvailableGM-Tg-cynog-IP0305-Ag-11mg/10mg/100mg/≥100mgCell culture, in vitro study, in vivo study, benchmark, drug discovery
FelineAvailableGM-Tg-felg-IP0305-Ag-11mg/10mg/100mg/≥100mgCell culture, in vitro study, in vivo study, benchmark, drug discovery
CanineAvailableGM-Tg-cang-IP0305-Ag-11mg/10mg/100mg/≥100mgCell culture, in vitro study, in vivo study, benchmark, drug discovery
BovineAvailableGM-Tg-bovg-IP0305-Ag-11mg/10mg/100mg/≥100mgCell culture, in vitro study, in vivo study, benchmark, drug discovery
EquineAvailableGM-Tg-bovg-IP0305-Ag-11mg/10mg/100mg/≥100mgCell culture, in vitro study, in vivo study, benchmark, drug discovery

While these products are commercially available, comprehensive comparative studies of AGPAT4 across these species remain limited in the published literature .

How does AGPAT4 expression change during mouse embryonic development?

The following table summarizes the quantitative changes in Agpat4 mRNA expression during murine embryonic development:

Developmental StageRelative Agpat4 mRNA ExpressionChange from Previous StageStatistical Significance
E10.5Baseline (set as 1.0)N/AN/A
E14.53.7-fold increase+270%P<0.05
E18.50.148-fold of E14.5 levels-96%P<0.05

These data demonstrate the dynamic regulation of Agpat4 during embryogenesis, with significant upregulation during mid-embryonic development (E14.5) followed by dramatic downregulation just prior to birth (E18.5) .

What are the quantitative changes in phospholipids in AGPAT4-deficient mouse brain?

The following table summarizes the changes in brain phospholipid content in Agpat4 knockout mice compared to wild-type littermates:

Phospholipid ClassChange in Agpat4 Knockout MicePercent ChangeStatistical Significance
Phosphatidylinositol (PI)-52%-52%P<0.05
Phosphatidylcholine (PC)-39%-39%P<0.05
Phosphatidylethanolamine (PE)-32%-32%P<0.05
Phosphatidylserine (PS)No significant changeN/ANot significant
Phosphatidylglycerol (PG)No significant changeN/ANot significant
Cardiolipin (CL)No significant changeN/ANot significant

These data demonstrate the specific impact of AGPAT4 deficiency on certain phospholipid classes, suggesting its role in maintaining the levels of PI, PC, and PE in the brain .

What are the key unanswered questions about bovine AGPAT4 function?

Despite progress in understanding AGPAT4 function, several important questions remain:

  • Substrate Specificity: What determines the apparent preference of AGPAT4 for generating PA that is specifically channeled toward PI, PC, and PE synthesis rather than other phospholipids?

  • Tissue-Specific Roles: Does bovine AGPAT4 function similarly across different bovine tissues, or does it have tissue-specific roles as suggested by studies in mice?

  • Regulatory Mechanisms: How is AGPAT4 activity regulated at the transcriptional, post-transcriptional, and post-translational levels?

  • Interaction Partners: What proteins interact with AGPAT4 to direct its products toward specific biosynthetic pathways?

  • Species Differences: How do the enzymatic properties and physiological roles of bovine AGPAT4 compare to those of other species, particularly humans?

Addressing these questions would significantly advance our understanding of AGPAT4 biology and its potential relevance to human and veterinary medicine.

What novel techniques could advance AGPAT4 research?

Several emerging technologies could significantly advance AGPAT4 research:

  • Cryo-electron Microscopy: Determining the detailed structure of AGPAT4 could provide insights into its catalytic mechanism and substrate specificity.

  • CRISPR/Cas9 Gene Editing: Precise modification of specific AGPAT4 domains or residues could help elucidate structure-function relationships.

  • Single-Cell Lipidomics: Analyzing phospholipid composition at the single-cell level could reveal cell-type-specific roles of AGPAT4.

  • Proximity Labeling Proteomics: Techniques such as BioID or APEX2 could identify proteins that interact with AGPAT4 in living cells.

  • Tissue-Specific Conditional Knockout Models: Generating animals with tissue-specific or inducible AGPAT4 deficiency could help dissect its roles in different tissues while avoiding developmental complications.

These approaches would complement existing techniques and potentially reveal new aspects of AGPAT4 biology that are currently inaccessible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.