Recombinant Bovine 2-acylglycerol O-acyltransferase 1 (MOGAT1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bovine 2-acylglycerol O-acyltransferase 1 (MOGAT1) is an enzyme that plays a vital role in lipid metabolism, specifically in the synthesis of diacylglycerol (DAG) and triacylglycerol (TAG) . MOGAT1 catalyzes the conversion of monoacylglycerols (MAG) to DAG, which is a precursor to phosphatidylcholine, phosphatidylethanolamine, and TAG .

Gene Information

Bovine MOGAT1 is located on chromosome 2 (BTA7) and consists of six exons and five introns . The MOGAT1 gene spans 34,976 base pairs and includes one transcript (splice variant), 220 orthologues, and nine paralogues (NC_037329.1, ENSBTAG00000008431) .

Tissue Expression

MOGAT1 expression is tissue-specific, with high expression levels observed in the kidney, stomach, and adipose tissue, but minimal expression in the normal adult liver .

Function

MOGAT1 is involved in reducing obesity and hepatic steatosis . It interacts with DGAT2, enhancing TAG biosynthesis and lipid droplet expansion, which can lead to increased lipid accumulation in the liver and fat . Studies have also indicated MOGAT1's effect on growth and milk fatty acid traits in cattle breeds .

Role in Lipid Metabolism

MOGAT1 is an enzyme that stimulates the synthesis of DAG and TAG in microsomal fractions . It has a role in triacylglycerol biosynthesis and hepatic steatosis .

MOGAT1 and MOGAT3

MOGAT3 is another enzyme involved in lipid metabolism, mainly expressed in the liver, adipose tissue, and testes . MOGAT3 exhibits higher DGAT activity than MOGAT1 and MOGAT2 when DAGs or MAGs are used as substrates .

MOGAT1 Inhibition

Inhibition of MOGAT1 has demonstrated improvements in hepatic metabolic abnormalities without reducing liver inflammation and injury . Studies involving mice fed a high-fat diet showed that ASO-mediated knockdown of Mogat1 markedly improves hepatic insulin signaling and systemic glucose metabolism .

Effects of MOGAT1 Knockdown

  • Reduced Hepatic TAG Content: MOGAT1 ASO administration reduced hepatic TAG content compared with high-fat diet control mice .

  • Increased Fatty Acid Oxidation: Rates of palmitate oxidation were significantly increased by MOGAT1 ASO treatment .

  • Reduced Lipogenesis: Rates of fatty acid synthesis were significantly reduced by MOGAT1 ASO treatment .

  • Down-regulation of DGAT2: Expression of DGAT2, which acylates DAG to form TAG, was down-regulated by MOGAT1 ASO .

Transcriptional Regulation of MOGAT1

The mouse and human MOGAT1 promoters contain several peroxisome proliferator response element (PPRE) binding sites . These sites respond to all three peroxisome proliferator-activated receptor (PPAR) isoforms, such that their respective agonist or antagonist activated or inhibited the expression of MOGAT1 .

PPRE Sites

PPRE site mutagenesis revealed that sites located at -592 and -2518 are very effective in decreasing luciferase reporter gene activity . Chromatin immunoprecipitation (ChIP) assay using PPARα antibody further confirmed the occupancy of these sites by PPARα .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MOGAT1; 2-acylglycerol O-acyltransferase 1; Acyl CoA:monoacylglycerol acyltransferase 1; MGAT1; Monoacylglycerol O-acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
MOGAT1
Target Protein Sequence
MKVEFAPLNIPLARRLQTAAVLHWLLSFLLFAQVCLGIIVFLIIYNYWFLYLPYLTWLYF DWQTPEQGGRRSEWVRNWAIWRYFKDYFPIHLIKTWDLDPSHNYIFGFHPHGVLVVGAFG NFCTNYSAFKELFPGFTSYLHVLPYWFRCPLFREYLMSSGPVSVSKKSVCHVLSKEGGGN ISVIVLGGAEESLDAHPGKFTLFIRQRKGFVKIALTHGAYLVPVFSFGENELFKQVSNPE GSWLRNVQEKLQKIMGFALPLFHARGIFQYNFGLIPYRKPIHTVVGRPIPVRQTLNPTSE QIEELHQTYMEELRKLFEEHKGKYGIPENETLIFR
Uniprot No.

Target Background

Function
Recombinant Bovine 2-acylglycerol O-acyltransferase 1 (MOGAT1) catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Its involvement in dietary fat absorption in the small intestine is likely minimal.
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary enzymatic function of bovine MOGAT1?

Bovine 2-acylglycerol O-acyltransferase 1 (MOGAT1) catalyzes the conversion of monoacylglycerol to diacylglycerol, representing the penultimate step in one pathway of triacylglycerol synthesis. This enzyme plays a critical role in lipid metabolism, particularly in the liver and adipose tissue. The catalytic action involves the transfer of an acyl group from acyl-CoA to monoacylglycerol, forming diacylglycerol that can subsequently be converted to triacylglycerol . When designing experiments involving MOGAT1, researchers should consider its specificity for different monoacylglycerol species and acyl-CoA donors to accurately assess enzymatic activity.

How does recombinant bovine MOGAT1 compare structurally to human and murine orthologs?

Recombinant bovine MOGAT1 shares significant structural homology with human and murine orthologs, reflecting its conserved function across mammalian species. The enzyme belongs to the DGAT2 family, which includes other acyltransferases involved in lipid metabolism. While specific sequence variations exist between species, the catalytic domains remain highly conserved. Human MOGAT1 is also known by alternative names including DGAT2L, DGAT2L1, and MGAT1, while murine Mogat1 is known by names including Dgat2l1, mDC2, and several other identifiers (0610030A14Rik, 1110064N14Rik, WI1-2612I11.1) . For experimental design, understanding these interspecies structural similarities and differences is crucial when using bovine MOGAT1 as a model for human metabolic diseases.

What expression systems are most effective for producing functional recombinant bovine MOGAT1?

Several expression systems have proven effective for producing functional recombinant bovine MOGAT1, each with specific advantages for different research applications:

Expression SystemPurity LevelApplicationsAdvantagesLimitations
Cell-Free Expression≥85% (SDS-PAGE)Structural studies, Enzyme assaysRapid production, No cellular toxicity concernsMay lack post-translational modifications
E. coli≥85% (SDS-PAGE)Western blot, ELISA, Basic assaysHigh yield, Cost-effectiveMay form inclusion bodies, Limited PTMs
Yeast≥85% (SDS-PAGE)Functional studiesEukaryotic PTMs, High yieldDifferent glycosylation patterns
Baculovirus≥85% (SDS-PAGE)Complex functional studiesNear-native PTMs, High expressionTechnical complexity, Higher cost
Mammalian Cell≥85% (SDS-PAGE)In vitro models, PTM studiesNative-like PTMs, Proper foldingLower yield, Highest cost

The choice of expression system should align with specific experimental needs. For basic enzymatic studies, E. coli or cell-free systems may be sufficient, while studies requiring post-translational modifications might necessitate mammalian expression systems .

What are the recommended purification protocols for obtaining high-purity recombinant bovine MOGAT1?

Purification of recombinant bovine MOGAT1 typically follows a multi-step process to achieve research-grade purity (≥85% as determined by SDS-PAGE). The recommended purification protocol varies depending on the expression system but generally includes:

  • Cell lysis using appropriate buffer systems (typically containing protease inhibitors)

  • Initial capture using affinity chromatography (His-tag purification for His-tagged constructs)

  • Intermediate purification using ion-exchange chromatography

  • Polishing step using size-exclusion chromatography

  • Quality control assessment via SDS-PAGE and Western blotting

For experimental reproducibility, protein purity should be verified using multiple methods, including SDS-PAGE, Western blotting, and when possible, mass spectrometry. The specific buffer conditions, pH, and salt concentrations must be optimized to maintain MOGAT1 stability and enzymatic activity throughout the purification process .

How can researchers accurately measure the enzymatic activity of recombinant bovine MOGAT1 in vitro?

Accurate measurement of recombinant bovine MOGAT1 enzymatic activity requires carefully designed in vitro assays that reflect the enzyme's physiological function. The standard methodological approach includes:

  • Preparation of substrate mixtures containing monoacylglycerol and acyl-CoA donors

  • Incubation with purified recombinant MOGAT1 under controlled temperature and pH conditions

  • Quantification of diacylglycerol formation using chromatographic methods (HPLC, TLC, or LC-MS/MS)

  • Calculation of specific activity (nmol product formed/min/mg enzyme)

When conducting these assays, researchers should control for potential interfering factors such as substrate micelle formation, enzyme stability, and product inhibition. Additionally, kinetic parameters (Km, Vmax) should be determined using varying substrate concentrations to fully characterize the enzyme's catalytic properties. Radiometric assays using 14C-labeled substrates can also provide high sensitivity for detecting enzymatic activity in samples with low MOGAT1 concentration .

What validated antibodies and detection methods are available for bovine MOGAT1 in research applications?

Several validated antibodies and detection methods are available for bovine MOGAT1 research, each suited to specific applications:

Antibody TypeHostApplicationsDetection SensitivityNotes
Polyclonal IgGRabbitELISA, IHC, IFHigh for tissue samples>95% purity, Protein G purified
HRP-conjugatedRabbitELISAHigh throughputOptimized for quantitative assays
MonoclonalVariousWestern Blot, IFHigh specificityApplication-specific validation required

For immunohistochemistry and immunofluorescence studies, proper sample preparation, including appropriate fixation and antigen retrieval techniques, is critical for detecting MOGAT1 in bovine tissues. When selecting antibodies, cross-reactivity with related enzymes (MOGAT2, DGAT1, DGAT2) should be evaluated to ensure specificity. Additionally, recombinant bovine MOGAT1 can serve as a positive control for antibody validation experiments .

How does MOGAT1 inhibition affect hepatic metabolism in metabolic disease models?

Studies investigating MOGAT1 inhibition in metabolic disease models have revealed complex metabolic effects that extend beyond simple lipid metabolism alterations. Antisense oligonucleotide (ASO)-mediated knockdown of MOGAT1 in diet-induced obese mouse models has demonstrated:

  • Significant improvement in glucose tolerance and hepatic insulin signaling

  • Reduction in hepatic triacylglycerol (TAG) content

  • Attenuation of weight gain in high-fat diet conditions

  • Increased rates of fatty acid oxidation in isolated hepatocytes

  • Reduced rates of de novo lipogenesis

  • Decreased TAG synthesis rates

What experimental approaches can resolve the mechanistic discrepancy between metabolic improvements and inflammatory responses in MOGAT1 inhibition studies?

The observed discrepancy between metabolic improvements and persistent inflammatory responses following MOGAT1 inhibition represents a significant research question. To address this mechanistic paradox, the following experimental approaches are recommended:

  • Temporal analysis of metabolic and inflammatory changes:

    • Design time-course experiments to determine whether metabolic improvements precede or follow inflammatory changes

    • Utilize both short-term (3 weeks) and long-term (12+ weeks) inhibition protocols to assess temporal relationships

  • Cell-specific knockout models:

    • Develop hepatocyte-specific, adipocyte-specific, and macrophage-specific MOGAT1 knockout models

    • Compare phenotypes to determine tissue-specific contributions to both metabolic and inflammatory outcomes

  • Lipidomic profiling:

    • Perform comprehensive lipidomic analyses to identify specific lipid species (beyond bulk measurements of TAG, DAG, etc.) that might mediate inflammatory responses

    • Focus on bioactive lipid mediators with known inflammatory properties

  • Pathway analysis:

    • Utilize transcriptomic approaches (RNA-seq) to identify differentially regulated pathways

    • Compare pathway regulation between metabolic and inflammatory gene networks

This discrepancy between improved metabolism and persistent inflammation highlights the complex relationship between lipid metabolism and inflammatory pathways in the liver, requiring sophisticated experimental approaches to fully elucidate .

How can researchers design experiments to distinguish between MOGAT1 and MOGAT2 functions in bovine metabolic pathways?

Distinguishing between the specific functions of MOGAT1 and MOGAT2 in bovine metabolic pathways requires careful experimental design that accounts for their overlapping enzymatic activities. Recommended approaches include:

  • Selective inhibition strategies:

    • Design ASOs with confirmed specificity for either MOGAT1 or MOGAT2

    • Verify target selectivity through qPCR to ensure no cross-inhibition

    • Compare phenotypes of selective MOGAT1 vs. MOGAT2 knockdown

  • Substrate specificity profiling:

    • Determine the kinetic parameters (Km, Vmax) for both enzymes with various monoacylglycerol species

    • Identify substrate preferences that might distinguish physiological roles

  • Tissue-specific expression analysis:

    • Quantify relative expression levels of MOGAT1 versus MOGAT2 across bovine tissues

    • Correlate expression patterns with tissue-specific metabolic functions

  • Double knockdown studies:

    • Design experiments with both individual and simultaneous knockdown of MOGAT1 and MOGAT2

    • Assess additive, synergistic, or redundant effects on metabolic outcomes

Recent research has shown that while the HTF-C diet increased both MOGAT1 and MOGAT2 expression in the liver, specific ASO treatment against MOGAT1 did not significantly affect MOGAT2 expression, suggesting independent regulation and potentially distinct functions in hepatic metabolism .

What strategies can overcome common stability issues with recombinant bovine MOGAT1 during purification and storage?

Recombinant bovine MOGAT1, like many membrane-associated enzymes, presents specific stability challenges during purification and storage. These challenges can be addressed through several technical strategies:

  • Optimized buffer formulations:

    • Include appropriate detergents (0.05-0.1% non-ionic detergents like Triton X-100 or NP-40)

    • Add glycerol (10-20%) to prevent protein aggregation

    • Include reducing agents (1-5 mM DTT or β-mercaptoethanol) to maintain thiol groups

    • Consider adding specific stabilizing agents like trehalose or sucrose

  • Storage conditions optimization:

    • Determine optimal protein concentration (typically 0.5-1 mg/ml)

    • Aliquot to minimize freeze-thaw cycles

    • Validate stability at different temperatures (-80°C, -20°C, 4°C)

    • Consider flash-freezing in liquid nitrogen versus slow freezing

  • Stability assessment methods:

    • Monitor enzymatic activity over time under different storage conditions

    • Use thermal shift assays to identify stabilizing buffer components

    • Assess aggregation using dynamic light scattering or size-exclusion chromatography

Maintaining enzymatic activity throughout purification and storage is critical for reliable experimental results. Each new batch of recombinant MOGAT1 should be characterized for specific activity before use in critical experiments .

How can researchers address the challenge of MOGAT1 solubility in in vitro enzymatic assays?

MOGAT1 solubility challenges in in vitro enzymatic assays stem from its membrane-associated nature and hydrophobic substrate interactions. These challenges can be addressed through methodological refinements:

  • Substrate delivery optimization:

    • Use mixed micelle systems with appropriate detergent-to-substrate ratios

    • Employ liposome reconstitution for more physiologically relevant conditions

    • Test various detergents (Triton X-100, CHAPS, NP-40) at concentrations below CMC

  • Reaction condition optimization:

    • Determine optimal pH range (typically pH 7.0-8.0)

    • Optimize ionic strength and divalent cation concentrations

    • Test temperature dependence (25-37°C) for optimal activity versus stability

  • Protein engineering approaches:

    • Consider truncated constructs that maintain catalytic activity with improved solubility

    • Evaluate fusion tags (MBP, SUMO) that might enhance solubility while maintaining activity

    • Test co-expression with stabilizing protein partners

A strategic approach to assay development involves systematic optimization of these parameters, with activity validation at each step to ensure that solubility improvements do not compromise enzymatic function. Recombinant MOGAT1 with ≥85% purity as determined by SDS-PAGE provides a suitable starting material for such optimizations .

What are the critical quality control parameters for validating recombinant bovine MOGAT1 before experimental use?

Comprehensive quality control of recombinant bovine MOGAT1 preparations is essential for experimental reliability and reproducibility. Critical quality control parameters include:

Quality ParameterMethodAcceptance CriteriaPurpose
PuritySDS-PAGE≥85%Ensures minimal contaminant proteins
IdentityWestern Blot/Mass SpecPositive identificationConfirms correct protein identity
Enzymatic ActivityAcyltransferase Assay≥70% of reference activityVerifies functional integrity
EndotoxinLAL/Chromogenic Assay<1.0 EU/mgPrevents interference in cellular assays
AggregationDLS/SEC<10% aggregatesEnsures homogeneity
Host Cell ProteinELISA<100 ng/mgMinimizes background interference
Host Cell DNAqPCR<10 ng/mgEnsures safety for in vivo applications

A thorough quality control process should document these parameters for each batch of recombinant MOGAT1, establishing release criteria that ensure consistent experimental performance. For critical experiments, it is advisable to use protein from the same production batch to minimize inter-experimental variability .

What are the promising therapeutic implications of targeting MOGAT1 in metabolic disorders?

Research on MOGAT1 inhibition has revealed promising therapeutic potential for metabolic disorders, particularly those involving hepatic steatosis and insulin resistance. The current evidence suggests several key therapeutic implications:

  • Improved glucose homeostasis:

    • ASO-mediated knockdown of MOGAT1 markedly improves hepatic insulin signaling and systemic glucose metabolism

    • This effect persists even with concurrent hepatic inflammation, suggesting direct metabolic benefits

    • The improvement in glucose tolerance could benefit patients with type 2 diabetes and insulin resistance

  • Reduced hepatic lipid accumulation:

    • MOGAT1 inhibition decreases hepatic triacylglycerol content

    • The mechanism involves both increased fatty acid oxidation and reduced lipogenesis

    • These effects could potentially reduce hepatic steatosis in NAFLD patients

  • Weight management potential:

    • Studies show attenuation of weight gain with MOGAT1 inhibition in diet-induced obese models

    • This effect might provide additional metabolic benefits beyond direct hepatic actions

What novel methodological approaches might reveal new insights into MOGAT1 regulation and tissue-specific functions?

Advanced methodological approaches are needed to fully elucidate MOGAT1 regulation and tissue-specific functions. Promising novel techniques include:

  • Single-cell transcriptomics and proteomics:

    • Apply single-cell RNA-seq to identify cell-specific expression patterns within heterogeneous tissues

    • Use single-cell proteomics to characterize post-translational regulation

    • This approach could reveal previously unrecognized cell-specific roles within tissues

  • Proximity labeling proteomics:

    • Employ BioID or APEX2 fusion proteins to identify proximal protein interactors of MOGAT1

    • Map the dynamic interactome under different metabolic conditions

    • This method could uncover regulatory proteins and metabolic complexes

  • In situ enzyme activity mapping:

    • Develop activity-based probes specifically targeting MOGAT1

    • Apply spatial transcriptomics to correlate activity with expression patterns

    • These techniques would provide spatial context to MOGAT1 function

  • CRISPR-based screening:

    • Conduct genome-wide CRISPR screens to identify regulators of MOGAT1 expression

    • Use CRISPR activation/inhibition libraries to characterize downstream effects

    • This approach could identify new therapeutic targets within MOGAT1 pathways

These methodological innovations would address current knowledge gaps regarding tissue-specific regulation and potentially identify novel therapeutic approaches beyond direct enzyme inhibition .

How might comparative studies between bovine and human MOGAT1 inform translational research in metabolic diseases?

Comparative studies between bovine and human MOGAT1 offer valuable insights for translational research in metabolic diseases. Key research approaches and their potential impact include:

Bovine models offer significant advantages for translational research due to similar metabolic physiology, larger tissue samples for analysis, and the potential to study natural variations in metabolism across breeds. These comparative approaches could accelerate the development of MOGAT1-targeted therapeutics while providing deeper mechanistic insights .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.