Recombinant Bovine 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B)

Recombinant Bovine 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B) is an enzyme that catalyzes essential steps in the biosynthesis of steroid hormones . Specifically, HSD3B facilitates the oxidation and isomerization of Δ5-3β-hydroxysteroid precursors into Δ4-ketosteroids .

Biochemical Function

HSD3B is a NAD+-dependent membrane-bound enzyme that is found in the endoplasmic reticulum and mitochondria . The enzyme plays a critical role in the production of all classes of active steroid hormones .

Genetic Aspects of HSD3B

In humans, two isoforms, HSD3B1 and HSD3B2, are encoded by the HSD3B1 and HSD3B2 genes respectively . HSD3B1 is expressed in the placenta and peripheral tissues, while HSD3B2 is predominantly expressed in the adrenal gland, ovary, and testis .

Clinical Significance

Deficiency in HSD3B2 is associated with a rare form of congenital adrenal hyperplasia . Variations in the HSD3B1 and HSD3B2 genes may influence the pathophysiology of steroid hormone-related diseases .

Research on Human HSD3B Isoenzymes

A study systematically identified polymorphisms and haplotypes in the genes encoding human HSD3B1 and HSD3B2 . The study involved resequencing HSD3B1 and HSD3B2 using DNA samples from different ethnic groups, identifying single nucleotide polymorphisms (SNPs) . Functional genomic studies revealed that some polymorphisms resulted in significant decreases in enzyme protein expression .

Methodology in Studying HSD3B

6.1. Construction of Plasmids
Wild type (WT) HSD3B1 and HSD3B2 cDNA sequences were cloned into the expression vector pcDNA4/HisMax-TOPO® TA . Site-directed mutagenesis using circular PCR was employed to create variant allozyme expression constructs .

6.2. Western Blot Analyses
Supernatant lysates of COS-1 cells transfected with WT and variant allozyme expression constructs were used for Western blot analyses . The lysates were run on SDS gels, transferred to PVDF membranes, and blotted with monoclonal anti-His antibody .

6.3. In Vitro Translation and Degradation
Transcription and translation of HSD3B1 and HSD3B2 allozymes were performed using the TnT® coupled rabbit reticulocyte lysate (RRL) System .

6.4. Quantitative RT-PCR
mRNA was isolated using the RNeasy Mini Kit from COS-1 cells transfected with expression constructs for HSD3B1 WT and Phe96 allozymes . RT-PCR was performed with primers for HSD3B1 and β-galactosidase as an internal standard .

6.5. Luciferase Reporter Gene Constructs
Approximately 1000 bp of HSD3B1 or HSD3B2 5′-FR sequence was amplified from human genomic DNA samples . The amplicons were subcloned into pGL-3 Basic upstream of the firefly luciferase gene ORF .

6.6. Immunofluorescence Microscopy
COS-1 cells were transfected with HSD3B expression constructs, fixed with paraformaldehyde, and incubated with primary antibodies, including a rabbit polyclonal anti-human antibody against calnexin, an endoplasmic reticulum marker .

Data Analysis

DNA sequences were compared with HSD3B1 and HSD3B2 genomic and cDNA genomic consensus sequences . Average levels of recombinant allozyme immunoreactive protein and luciferase activities were compared by ANOVA . Linkage disequilibrium among HSD3B1 and HSD3B2 polymorphisms was determined by calculating D' values .

Single Nucleotide Polymorphisms (SNPs)

Resequencing of the HSD3B1 and HSD3B2 genes identified seventeen SNPs in HSD3B1, including five non-synonymous cSNPs (Ile79Val, Ser96Phe, Asp242Asn, Phe286Leu, and Asn367Thr), and nine SNPs in HSD3B2 .

Select HSD3B Data

GeneSNPs IdentifiedNon-Synonymous cSNPs
HSD3B117Ile79Val, Ser96Phe, Asp242Asn, Phe286Leu, Asn367Thr
HSD3B29Not specified

Other Research

  • VISFATIN (NAMPT) and Steroidogenesis: In cultured bovine granulosa cells, VISFATIN improves basal and IGF1-induced steroidogenesis and IGF1 receptor signaling through SIRT1 .

  • Transcriptional Regulation of Steroidogenic Genes: Hormonal and transcriptional regulation of STARD1, CYP11A1, and specific steroidogenic HSD3B were reviewed .

  • TGFB1 Role: The role of transforming growth factor-b1 (TGFB1) in the regulation of estradiol-17b (E2) and progesterone (P4) was determined .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
HSD3B; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase; 3-beta-HSD [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase; Steroid Delta-isomerase; Delta-5-3-ketosteroid isomerase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
HSD3B
Target Protein Sequence
AGWSCLVTGGGGFLGQRIICLLVEEKDLQEIRVLDKVFRPEVREEFSKLQSKIKLTLLEG DILDEQCLKGACQGTSVVIHTASVIDVRNAVPRETIMNVNVKGTQLLLEACVQASVPVFI HTSTIEVAGPNSYREIIQDGREEEHHESAWSSPYPYSKKLAEKAVLGANGWALKNGGTLY TCALRPMYIYGEGSPFLSAYMHGALNNNGILTNHCKFSRVNPVYVGNVAWAHILALRALR DPKKVPNIQGQFYYISDDTPHQSYDDLNYTLSKEWGFCLDSRMSLPISLQYWLAFLLEIV SFLLSPIYKYNPCFNRHLVTLSNSVFTFSYKKAQRDLGYEPLYTWEEAKQKTKEWIGSLV KQHKETLKTKIH
Uniprot No.

Target Background

Function

3β-Hydroxysteroid dehydrogenase/Δ54-isomerase (3β-HSD) is a bifunctional enzyme catalyzing the oxidative conversion of Δ5-ene-3β-hydroxy steroids and the oxidative conversion of ketosteroids. The 3β-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of steroid hormones.

Gene References Into Functions
  1. Granulosa and theca cells from large bovine follicles were isolated before and after the LH surge. CYP19A1, HSD3B1, and CYP17A1 transcript levels were quantified by real-time PCR (qPCR), and chromatin condensation was assessed. PMID: 21069797
  2. Mapping of the bovine HSD3B1 gene to bovine chromosome 3. PMID: 16717461
  3. Serum-free culture conditions significantly upregulated Cyp17 and Csh1 expression, but not Hsd3b expression, in trophoblasts. PMID: 18455233
Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the function of bovine HSD3B in steroid hormone biosynthesis?

HSD3B functions as a bifunctional enzyme that catalyzes two sequential reactions in steroid hormone biosynthesis:

  • The oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroids to 3-oxo-Delta(5)-steroids using NAD+ as a cofactor

  • The isomerization of these intermediates to form 3-oxo-Delta(4)-steroids

These reactions can be represented biochemically as:

  • 3-beta-hydroxy-Delta(5)-steroid + NAD+ = 3-oxo-Delta(5)-steroid + NADH

  • 3-oxo-Delta(5)-steroid = 3-oxo-Delta(4)-steroid

This enzymatic system is essential for converting pregnenolone to progesterone and dehydroepiandrosterone (DHEA) to androstenedione, critical steps in the biosynthesis of all classes of steroid hormones including glucocorticoids, mineralocorticoids, androgens, and estrogens .

How does bovine HSD3B compare to human HSD3B isoforms?

Humans have two main HSD3B isoforms (HSD3B1 and HSD3B2), while bovine samples primarily express HSD3B1. Key comparative aspects include:

  • Functional similarities:

    • Both bovine and human HSD3B catalyze the same biochemical reactions

    • Both are involved in steroid hormone biosynthesis pathways

  • Expression patterns:

    • Human HSD3B1: Primarily expressed in placenta and peripheral tissues

    • Human HSD3B2: Expressed in adrenal glands and gonads

    • Bovine HSD3B1: Expressed in steroidogenic tissues including adrenal cortex, ovaries, and testes

  • Enzymatic activities:

    • Studies show that human HSD3B1 generally exhibits higher enzymatic activity than HSD3B2, though this difference is not always statistically significant

    • Bovine HSD3B1 shows comparable activity to human isoforms in reconstitution studies

  • Clinical relevance:

    • Mutations in human HSD3B2 cause congenital adrenal hyperplasia (CAH)

    • SNPs in human HSD3B1 are associated with breast and prostate cancers

    • Bovine HSD3B is primarily studied in the context of reproductive biology and agriculture

What methods can be used to accurately evaluate the enzymatic activity of recombinant bovine HSD3B?

Several methodological approaches can be employed to assess HSD3B activity:

  • Cell-based reporter assay system:

    • This highly sensitive method uses HEK293 cells expressing HSD3B

    • Cells are incubated with media containing substrates (pregnenolone or DHEA)

    • The culture media containing converted products is transferred to CV-1 cells transfected with:
      a) PR/AR expression vector (progesterone/androgen receptors)
      b) Progesterone-/androgen-responsive luciferase reporter

    • Luciferase activity directly correlates with HSD3B enzymatic activity

  • Direct biochemical assays:

    • Spectrophotometric measurement of NADH production during the oxidative reaction

    • HPLC or mass spectrometry to quantify substrate conversion to products

    • Radioimmunoassay or ELISA for specific steroid hormone products

  • Comparative analysis approach:

    • Activity can be compared between wild-type and mutant proteins

    • Time-course experiments demonstrate progressive increases in product formation

    • Control experiments (GFP-transfected cells) should show no enzymatic activity

The cell-based reporter system offers particular advantages for detecting even low levels of enzymatic activity and can evaluate activity toward multiple substrates simultaneously.

How should experimental conditions be optimized for storing and handling recombinant bovine HSD3B?

Optimal storage and handling conditions for recombinant bovine HSD3B include:

  • Storage recommendations:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • After reconstitution, store aliquots at -20°C/-80°C for long-term storage

    • Working aliquots can be maintained at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they significantly reduce enzymatic activity

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Prepare multiple single-use aliquots

  • Buffer considerations:

    • Storage buffer typically contains Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • For enzymatic assays, ensure availability of the NAD+ cofactor

    • Consider adding reducing agents to maintain cysteine residues in their reduced state

  • Experimental validation:

    • Before large-scale experiments, verify enzyme activity using a small aliquot

    • Include positive and negative controls in all experimental setups

    • Consider the temperature sensitivity of the enzyme during experimental design

How can researchers establish structure-function relationships for HSD3B through mutational analysis?

To investigate structure-function relationships in HSD3B, researchers can employ the following approaches:

  • Site-directed mutagenesis strategy:

    • Target conserved residues across species

    • Focus on residues in predicted active sites or substrate-binding regions

    • Create alanine scanning mutations across functional domains

    • Generate mutations that mimic known human disease variants

  • Expression systems:

    • Express wild-type and mutant proteins in HEK293 cells

    • Ensure equivalent expression levels through western blotting

    • Use the cell-based reporter system to evaluate enzymatic activity

  • Activity correlation approach:

    • Test each mutant with multiple substrates (pregnenolone and DHEA)

    • Quantify residual activities as percentages of wild-type activity

    • Correlate enzymatic deficiencies with structural locations of mutations

    • For human disease-associated mutations, relate enzymatic activity to clinical phenotypes

  • Data analysis and interpretation:

    • Compare activities toward different substrates to identify substrate-specific effects

    • Analyze the relationship between mutation location and enzyme function

    • Use molecular modeling to predict structural impacts of mutations

    • Integrate findings with known HSD3B structural features

This comprehensive approach enables researchers to understand how specific amino acid residues contribute to catalytic function and substrate specificity.

What is the recommended protocol for setting up a cell-based reporter assay for HSD3B activity?

Based on the recent methodological developments, the following protocol is recommended for establishing a cell-based reporter assay:

  • Cell preparation and transfection:

    • Day 1: Seed HEK293 cells in 12-well plates at 2×10^5 cells/well

    • Day 2: Transfect with expression vectors for wild-type or mutant HSD3B using appropriate transfection reagent

    • Include GFP-transfected cells as negative control

  • Substrate conversion:

    • Day 3: Replace media with fresh media containing substrate:

      • For pregnenolone: 1 μM final concentration

      • For DHEA: 1 μM final concentration

    • Collect media at different time points (0, 6, 24 hours)

  • Reporter cell preparation:

    • Day 1: Seed CV-1 cells in 24-well plates at 5×10^4 cells/well

    • Day 2: Co-transfect with:

      • Progesterone receptor (PR) or androgen receptor (AR) expression vector

      • Progesterone-responsive or androgen-responsive luciferase reporter

      • Control Renilla luciferase vector for normalization

  • Reporter assay:

    • Day 3: Add collected media from HSD3B-expressing cells to reporter cells

    • Day 4: Harvest cells and measure firefly and Renilla luciferase activities

    • Calculate normalized luciferase activity (firefly/Renilla ratio)

  • Data analysis:

    • Express results as fold induction compared to media from control cells

    • For mutations, calculate percentage activity relative to wild-type protein

    • Perform time-course analysis to determine enzymatic kinetics

This system provides high sensitivity and can detect even low levels of enzymatic activity, making it ideal for characterizing mutations or testing inhibitors.

How can recombinant bovine HSD3B be used to study steroid hormone biosynthesis pathways?

Recombinant bovine HSD3B serves as an excellent tool for investigating steroid biosynthesis through multiple approaches:

  • Pathway reconstitution studies:

    • Co-express HSD3B with other steroidogenic enzymes (CYP11A1, CYP17A1, CYP19A1)

    • Measure sequential conversion of cholesterol to various steroid hormones

    • Identify rate-limiting steps in the pathway

    • Test the effects of cofactors and regulatory proteins

  • Comparative enzyme kinetics:

    • Determine substrate preferences and kinetic parameters (Km, Vmax)

    • Compare bovine HSD3B with human isoforms

    • Evaluate the effects of different cellular environments on activity

    • Study the impact of post-translational modifications

  • Inhibitor screening:

    • Use the cell-based reporter system to identify compounds that modulate HSD3B activity

    • Characterize mechanism of inhibition (competitive, non-competitive)

    • Develop isoform-specific inhibitors

    • Test natural compounds for regulatory effects

  • Tissue-specific regulation:

    • Compare HSD3B expression and activity across different bovine tissues

    • Correlate with steroid hormone production in these tissues

    • Investigate transcriptional and post-transcriptional regulation

    • Study the effects of physiological stimuli (e.g., LH surge) on enzyme expression

This multi-faceted approach provides comprehensive insights into steroid hormone biosynthesis and its regulation in both normal physiology and pathological conditions.

What are the advantages and limitations of using E. coli-expressed recombinant bovine HSD3B?

E. coli expression systems are commonly used for producing recombinant bovine HSD3B, offering distinct advantages and limitations:

Advantages:

  • High yield and cost-effectiveness

    • E. coli grows rapidly and produces protein in high quantities

    • Expression systems are well-established and economical

    • Purification via His-tag affinity chromatography is straightforward

  • Protein purity

    • Greater than 90% purity is typically achieved

    • SDS-PAGE can easily confirm protein quality

    • Large quantities can be produced for structural studies

  • Stability

    • When properly stored, lyophilized protein maintains activity

    • Addition of trehalose in storage buffer enhances stability

    • The protein can be shipped in lyophilized form

Limitations:

  • Post-translational modifications

    • E. coli lacks machinery for mammalian post-translational modifications

    • Potential lack of phosphorylation, glycosylation, or other modifications

    • May affect certain aspects of protein function

  • Membrane protein challenges

    • HSD3B is naturally membrane-associated

    • E. coli-expressed protein may not fold properly without lipid environment

    • Solubility issues may require optimization of expression conditions

  • Cofactor dependencies

    • NAD+ must be supplied for activity assays

    • Reduced availability of other potential cofactors in in vitro systems

    • May not recapitulate all aspects of in vivo activity

  • Species differences

    • Bovine HSD3B may have subtle functional differences from human isoforms

    • Caution needed when extrapolating findings to human physiology

    • Different substrate preferences may exist

Understanding these considerations is essential for designing experiments and interpreting results when working with E. coli-expressed recombinant bovine HSD3B.

How can research on bovine HSD3B inform our understanding of human disorders involving steroid metabolism?

Research on bovine HSD3B offers several important translational insights for human disease:

  • Congenital adrenal hyperplasia (CAH):

    • Mutations in human HSD3B2 cause a form of CAH

    • Bovine HSD3B serves as a structural and functional model for human enzyme

    • The cell-based reporter system allows evaluation of mutation effects on enzyme activity

    • This helps predict phenotype severity based on residual enzymatic function

  • Cancer biology:

    • HSD3B1 variants are associated with breast and prostate cancers in humans

    • Studies with bovine HSD3B can inform structure-function relationships

    • The enzyme represents a potential therapeutic target

    • The reporter system can identify inhibitors with potential clinical applications

  • Disorders of sex development (DSD):

    • HSD3B deficiency can lead to ambiguous genitalia and other DSDs

    • Bovine model helps understand the enzyme's role in fetal sex development

    • Studies can elucidate the impact of partial enzyme deficiencies on phenotype

    • Insights may improve diagnosis and management of these conditions

  • Reproductive disorders:

    • HSD3B is crucial for proper steroidogenesis in gonads

    • Bovine research can inform understanding of infertility and reproductive disorders

    • Findings may lead to new diagnostic approaches or treatments

The highly conserved nature of steroidogenic pathways across mammals makes bovine HSD3B research valuable for human medicine.

What role does HSD3B play in the regulation of steroidogenesis, and how can this be studied using recombinant protein?

HSD3B plays a central regulatory role in steroidogenesis through multiple mechanisms:

  • Pathway branch point control:

    • HSD3B directs precursors toward either mineralocorticoid/glucocorticoid or sex steroid pathways

    • The enzyme's activity determines the balance between these pathways

    • Recombinant protein can be used in reconstituted systems to study this branch point regulation

  • Tissue-specific regulation:

    • Different tissues exhibit varying levels of HSD3B expression and activity

    • In bovine follicles, HSD3B1 expression changes in response to the LH surge

    • Recombinant protein can be used as a standard to quantify endogenous enzyme levels

    • Cell-based systems can mimic tissue-specific environments

  • Subcellular compartmentalization:

    • HSD3B localizes to both endoplasmic reticulum and mitochondrial membranes

    • This compartmentalization affects access to substrates and interaction with other enzymes

    • Studies with tagged recombinant protein can track subcellular localization

  • Cofactor dependency:

    • NAD+ availability can regulate HSD3B activity

    • Redox state affects enzyme function

    • In vitro assays with recombinant protein can manipulate cofactor levels to study regulation

  • Protein-protein interactions:

    • HSD3B may interact with other steroidogenic enzymes in functional complexes

    • Co-expression studies with recombinant proteins can identify these interactions

    • Such interactions may enhance pathway efficiency through substrate channeling

Research with recombinant bovine HSD3B provides a controlled system to dissect these regulatory mechanisms, offering insights applicable to both animal science and human medicine.

What emerging techniques could enhance our ability to study HSD3B structure and function?

Several cutting-edge approaches hold promise for advancing HSD3B research:

  • Cryo-electron microscopy (cryo-EM):

    • Could resolve the 3D structure of HSD3B at near-atomic resolution

    • Would provide insights into substrate binding pockets and catalytic mechanisms

    • May reveal conformational changes during bifunctional catalysis

    • Could inform structure-based drug design

  • CRISPR-Cas9 genome editing:

    • Creation of precise mutations in the endogenous HSD3B gene

    • Study effects in their native genomic context

    • Generate isogenic cell lines differing only in HSD3B sequence

    • Examine the impact of regulatory elements on expression

  • Single-cell analysis techniques:

    • Investigate cell-to-cell variability in HSD3B expression

    • Correlate with steroid production at the single-cell level

    • Identify subpopulations with distinct regulatory patterns

    • Map temporal dynamics during differentiation or stimulation

  • Protein engineering approaches:

    • Design HSD3B variants with enhanced stability or activity

    • Create biosensors by fusing HSD3B with fluorescent proteins

    • Develop isoform-specific antibodies or activity probes

    • Engineer enzyme variants with altered substrate specificity

  • Systems biology integration:

    • Incorporate HSD3B into computational models of steroidogenesis

    • Predict effects of perturbations on hormone production

    • Identify non-intuitive regulatory relationships

    • Optimize experimental design through in silico modeling

These advanced approaches will deepen our understanding of HSD3B biology and potentially lead to new therapeutic strategies for steroid-related disorders.

How might inter-species differences in HSD3B inform evolutionary aspects of steroid hormone biosynthesis?

Comparative studies of HSD3B across species provide valuable evolutionary insights:

  • Sequence conservation analysis:

    • Highly conserved regions likely represent critical functional domains

    • Divergent regions may indicate species-specific adaptations

    • Recombinant proteins from multiple species can be compared functionally

    • Bovine, ovine, guinea pig, and human enzymes show distinct activity profiles

  • Isoform diversification:

    • Humans have two main isoforms (HSD3B1 and HSD3B2)

    • Different species have varying numbers of isoforms

    • The timing of gene duplication events can be studied

    • Functional specialization of isoforms reveals evolutionary pressures

  • Substrate preference evolution:

    • Species differences in preferred steroid substrates

    • May reflect adaptation to different reproductive strategies

    • Can be studied using the cell-based reporter system with recombinant enzymes

    • Provides insights into hormone-dependent speciation

  • Regulatory mechanism conservation:

    • Comparison of transcriptional and post-transcriptional regulation

    • Analysis of promoter regions across species

    • Examination of tissue-specific expression patterns

    • Correlation with reproductive and stress response strategies

  • Disease-related variants:

    • Natural variations that affect function in different species

    • Identification of compensatory mechanisms in species with variant enzymes

    • Insights into robustness of steroid biosynthesis pathways

    • Potential application to understanding human disease variants

This evolutionary perspective enhances our fundamental understanding of steroid hormone biology while potentially identifying novel regulatory mechanisms that could be targeted therapeutically.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.