Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

Shipped with Ice Packs

In Stock

Cat. No.

BT2061233

Source

in vitro E.coli expression system

Synonyms

HACD2; PTPLB; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 2; 3-hydroxyacyl-CoA dehydratase 2; HACD2; Protein-tyrosine phosphatase-like member B

Quick Inquiry

Description

Functional Role in Fatty Acid Metabolism

PTPLB catalyzes the dehydration of 3-hydroxyacyl-CoA intermediates during fatty acid elongation. This step is critical for converting saturated, monounsaturated, and polyunsaturated fatty acids (FAs) into very long-chain FAs (VLCFAs), which are essential for membrane lipids, cholesterol esters, and sphingolipids .

Comparative Activity of PTPLB and HACD1

Studies in Hacd1 knockout (KO) mice and human HAP1 cells reveal:

Enzyme	Activity in Saturated FAs	Activity in Unsaturated FAs	Tissue Specificity	Key Findings
PTPLB	High (major contributor)	High	Ubiquitous	Double KO of HACD1 and HACD2 in HAP1 cells reduces FA elongation by ~80% .
HACD1	Moderate	Moderate	Skeletal muscle (highest)	Hacd1 KO mice show ~40% reduction in skeletal muscle HACD activity .

Experimental Validation

Yeast Assays: Overexpression of PTPLB in yeast rescues FA elongation defects, confirming its role in both saturated and unsaturated pathways .
Cellular Disruption: CRISPR-mediated knockout of HACD2 in human cells significantly reduces elongation of C18 and longer FAs, while HACD1 KO has minimal impact .

Applications in Biomedical Research

PTPLB’s recombinant form is widely used to study:

Lipid Pathway Dynamics: Elucidating the interplay between HACD1 and PTPLB in VLCFA synthesis .
Disease Modeling: Investigating myopathies linked to HACD1 mutations, where PTPLB compensatory activity may influence disease progression .
Therapeutic Targeting: Exploring inhibitors or modulators of PTPLB for lipid-related disorders (e.g., sphingolipidoses) .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.

Lead Time

Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.

Notes

Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.

Reconstitution

For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.

Shelf Life

Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.

Storage Condition

Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type is determined during the manufacturing process.

The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that tag.

Synonyms

HACD2; PTPLB; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 2; 3-hydroxyacyl-CoA dehydratase 2; HACD2; Protein-tyrosine phosphatase-like member B

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

2-254

Protein Length

Full Length of Mature Protein

Species

Bos taurus (Bovine)

Target Names

HACD2

Target Protein Sequence

AAAAAIAASKGNGGGGGRAGAGEASSSRRKKGPGPLTTAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSIQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVS GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPLFPQLYFHMIHQRR KILSHTEEHKKFE

Uniprot No.

Q2KIP8

Target Background

Function

Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) is an enzyme that catalyzes the third step in the very long-chain fatty acids (VLCFA) elongation four-step cycle. This cycle involves condensation, reduction, dehydration, and reduction. The endoplasmic reticulum-elongation process is characterized by the addition of two carbons to the lipid chain with each cycle. PTPLB specifically catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of elongation. Therefore, it plays a crucial role in the production of various VLCFAs that are involved in multiple biological processes, acting as precursors for membrane lipids and lipid mediators.

Database Links

KEGG: bta:613886

STRING: 9913.ENSBTAP00000032212

UniGene: Bt.105143

Protein Families

Very long-chain fatty acids dehydratase HACD family

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

Description

Functional Role in Fatty Acid Metabolism

Comparative Activity of PTPLB and HACD1

Experimental Validation

Applications in Biomedical Research

Product Specs

Target Background

Quick Inquiry

Category

Service