Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1)

Shipped with Ice Packs

In Stock

Cat. No.

BT2117148

Source

in vitro E.coli expression system

Synonyms

HACD3; PTPLAD1; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 3; 3-hydroxyacyl-CoA dehydratase 3; HACD3; Protein-tyrosine phosphatase-like A domain-containing protein 1

Quick Inquiry

Description

Introduction to Recombinant Bovine 3-Hydroxyacyl-CoA Dehydratase 3 (PTPLAD1)

Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1), also known as HACD3, is an engineered enzyme produced via heterologous expression systems for biochemical and pharmaceutical research. This protein catalyzes the third step of fatty acid elongation, converting 3-hydroxyacyl-CoA intermediates into trans-2,3-enoyl-CoA, a critical process for synthesizing very-long-chain fatty acids (VLCFAs) essential for membrane lipids and signaling molecules .

Production and Purification

Recombinant bovine PTPLAD1 is produced in two primary systems:

Parameter	Yeast Expression	E. coli Expression
Host	Saccharomyces cerevisiae	Escherichia coli
Tag	Undisclosed	N-terminal 10xHis
Purity	>85% (SDS-PAGE)	Full-length, no purity specified
Storage	Lyophilized (-20°C/-80°C)	Liquid (-20°C/-80°C)
Reconstitution	0.1–1.0 mg/mL in sterile water	Not required

Enzymatic Activity and Substrate Specificity

PTPLAD1 exhibits specificity for long- and very-long-chain 3-hydroxyacyl-CoA substrates:

Substrate	Activity Level	Biological Role
Saturated FAs	Moderate	Membrane lipid synthesis
Monounsaturated FAs	Moderate	Energy storage
Polyunsaturated FAs	Low	Lipid mediator production

Key findings:

Redundant activity: Works alongside HACD1/2 in elongation pathways but shows weaker activity in saturated/monounsaturated FA synthesis .
Autophagic regulation: Competes with SQSTM1/p62 to stabilize viral PB1 protein, suggesting moonlighting roles .

Research Applications

Fatty Acid Metabolism Studies: Used to elucidate VLCFA elongation mechanisms .
Membrane Fluidity Research: Partners with ACSL4 to incorporate polyunsaturated fatty acids into phospholipids .
Drug Development: Investigated for insulin receptor modulation and antiviral therapies .

Comparative Insights Across Species

Species	Homolog	Key Functional Difference
Human	HACD3	Involved in insulin receptor signaling
C. elegans	HPO-8	Membrane fluidity regulation
Yeast	Phs1	Primary dehydratase in VLCFA synthesis

Challenges and Future Directions

Low activity: Recombinant bovine PTPLAD1 shows weaker catalytic efficiency compared to HACD1/2, limiting industrial use .
Structural insights: Full-length crystal structures are needed to optimize enzyme engineering .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your desired format when placing your order, and we will prepare accordingly.

Lead Time

Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. For dry ice shipping, please contact us in advance. Additional fees will apply.

Notes

Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.

Reconstitution

We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.

Shelf Life

Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.

Storage Condition

Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type will be determined during the manufacturing process.

We select the tag type during production. If you have a specific tag preference, please let us know, and we will prioritize development with the specified tag.

Synonyms

HACD3; PTPLAD1; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 3; 3-hydroxyacyl-CoA dehydratase 3; HACD3; Protein-tyrosine phosphatase-like A domain-containing protein 1

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-362

Protein Length

Full length protein

Species

Bos taurus (Bovine)

Target Names

HACD3

Target Protein Sequence

MENQVLTPHVYWAQRHHELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPVYKLTQRQVNITVQKKESQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEEQLNKLRLESQGSPETLTSLKKGYLFMYNLVQFLGFSWIFVNMTVRFFILGKESF YDTFHTVADMMYFCQMLAAVESINAAIGVTKSPVVPSLFQLLGRNFILFIIFGTMEEMQN KAVVFFVFYIWSTVEIFRYPFYMLSCIDMDWKVLTWLRYTVWIPLYPMGCLAEAVSVIQS IPVFNETGRFSFTLPYPVKIKVRFSFFLQIYLILLFLGLYVNFRYLYKQRRRRFGQKKKK IH

Uniprot No.

A7YY55

Target Background

Function

This enzyme catalyzes the third step in the four-step long-chain fatty acid elongation cycle, which is an endoplasmic reticulum-bound process. This cycle enables the addition of two carbons per cycle to the chain of long- and very long-chain fatty acids (VLCFAs). Specifically, 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1) catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA within each elongation cycle. This process plays a crucial role in the production of VLCFAs of varying chain lengths, which are essential components of membrane lipids and lipid mediators. PTPLAD1 is also involved in Rac1-signaling pathways, modulating gene expression, promoting insulin receptor (INSR) autophosphorylation, and participating in INSR internalization.

Database Links

KEGG: bta:100125237

STRING: 9913.ENSBTAP00000036401

UniGene: Bt.67202

Protein Families

Very long-chain fatty acids dehydratase HACD family

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1)

Description

Introduction to Recombinant Bovine 3-Hydroxyacyl-CoA Dehydratase 3 (PTPLAD1)

Production and Purification

Enzymatic Activity and Substrate Specificity

Research Applications

Comparative Insights Across Species

Challenges and Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service