Recombinant Bovine 3-ketodihydrosphingosine reductase (KDSR)

Shipped with Ice Packs
In Stock

Description

Role in Bovine Spinal Muscular Atrophy (SMA)

A naturally occurring A175T mutation in bovine FVT1 (KDSR) causes SMA, a neurodegenerative disorder. This mutation abolishes enzymatic activity in vitro but allows partial function in vivo, explaining postnatal disease onset .

Key Findings from SMA Studies

  • In Vitro Activity:

    • Wild-type KDSR: Reduces 3KDS to dihydrosphingosine with NADPH .

    • A175T mutant: No detectable activity due to disrupted substrate binding .

  • In Vivo Complementation:

    • Yeast lacking TSC10 (KDSR ortholog) survive when expressing wild-type bovine KDSR.

    • A175T mutant partially rescues yeast viability, suggesting residual function or compensatory mechanisms .

AssayWild-Type KDSRA175T MutantOutcome
In VitroActiveInactiveComplete loss of 3KDS reduction
In Vivo (Yeast)Fully functionalPartial functionViability retained in yeast model

Enzymatic Activity and Mutation Impact

The A175T mutation disrupts the enzyme’s catalytic efficiency by altering the local conformation near the active site. Thr-175’s bulkier side chain may interfere with substrate binding or NADPH interaction .

Mechanism of Toxicity in SMA

  • 3KDS Accumulation: Inactive KDSR leads to elevated 3KDS levels, which disrupt endoplasmic reticulum (ER) function and proteostasis .

  • ER Stress and Unfolded Protein Response: 3KDS accumulation triggers upregulation of ER chaperones (e.g., HSPA5) and ubiquitin-dependent degradation pathways, causing neuronal toxicity .

Recombinant Production and Applications

While direct data on bovine KDSR recombinant production is limited, yeast-based systems have been used to study its function. For example, bovine FVT1 was expressed in Saccharomyces cerevisiae to assess mutant complementation .

SystemHostPurposeOutcome
Yeast ComplementationS. cerevisiaeTest A175T mutant functionality in vivoPartial rescue of yeast viability
In Vitro Enzyme AssayBacterial lysateMeasure 3KDS reduction activityA175T mutant: No activity detected

Research Findings and Clinical Implications

  • Bovine SMA as a Model: The A175T mutation provides an animal model to study SMA pathogenesis, highlighting the sensitivity of motor neurons to metabolic disruptions .

  • Therapeutic Potential: Targeting 3KDS detoxification or sphingolipid biosynthesis may offer strategies for SMA treatment, though translation to humans requires further validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KDSR; FVT1; 3-ketodihydrosphingosine reductase; KDS reductase; 3-dehydrosphinganine reductase; Follicular variant translocation protein 1 homolog; FVT-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-331
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
KDSR
Target Protein Sequence
KPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKHSINDKQ VVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFERLMSIN YLGSVYPSRAVIATMKERRMGRVVFVSSQAGQLGLFGYTAYSSSKFALRGLAEALQMEVK PYNVYVTVAYPPDTDTPGFAKENQTKPLETRLISETTSVCKPEQVAKQIVKDVQGNFNSS IGSDGYMLSSLTCGMAPVTSIMEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQKAKLE TVDKTA
Uniprot No.

Target Background

Function
This enzyme catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Gene References Into Functions
  1. A G-to-A missense mutation in the FVT1 gene, encoding 3-ketodihydrosphingosine reductase, is strongly implicated in bovine spinal muscular atrophy. PMID: 17420465
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.