Recombinant Bovine Abhydrolase domain-containing protein 3 (ABHD3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bovine Abhydrolase Domain-Containing Protein 3 (ABHD3)

Recombinant Bovine Abhydrolase domain-containing protein 3 (ABHD3) is a protein produced through in vitro E. coli expression systems . ABHD3 belongs to the alpha/beta hydrolase domain (ABHD) family, which is involved in lipid metabolism and signaling . ABHD3 may play a role in phospholipid remodeling and may selectively cleave myristate (C14)-containing phosphatidylcholines .

Characteristics and Functions

  • Role in Lipid Metabolism ABHD proteins, including ABHD3, play essential roles in lipid metabolism, lipid signal transduction, and metabolic diseases .

  • Enzyme Class ABHD3 functions as a phospholipase .

  • Regulation of Expression The expression of ABHD3 is regulated under various conditions. For instance, it is upregulated in the early response to chemotherapy treatment in human ovarian cancer cell lines and has been identified in a screen for pro-apoptotic genes, being upregulated in microarrays of breast cancer tumors . ABHD3 is also upregulated in a human osteosarcoma cell line overexpressing HIC1 (Hypermethylated in Cancer 1) . Conversely, ABHD3 is downregulated in peripheral blood mononuclear cells (PBMCs) from patients with Crohn's disease, and its promoter contains binding sites for transcription factors like T-bet and Early Growth Response (EGRF) .

ABHD3 Inhibitors

Several compounds have been identified as inhibitors of ABHD3, including:

  • N-methyliminodiacetic acid-containing (MIDA) boronates A specific compound, β-aminocyano(MIDA)boronate (2), showed potent ABHD3 inhibition with an IC50 value of 0.14 μM in vitro. Selectivity was confirmed using MS-based ABPP, showing >95% blockade of ABHD3 at 0.5 μM without affecting 60 other serine hydrolases in the human colon cancer cell line SW620 .

  • N-hydroxyhydantoin carbamates Compounds 5 (ABC47) and 6 (ABC34) showed activity on ABHD3 (IC50 = 0.1 and 7.6 μM, respectively), but also inhibited ABHD4 more potently. Further studies in human PC3 cells indicated that these compounds also targeted ABHD6, hormone-sensitive lipase (HSL), phospholipase A2 Group VII (PLA2G7), and carboxylesterase 2 (CES2) .

Implications of ABHD3 Inhibition

Metabolomic studies have shown that ABHD3 inhibition leads to an increase of medium-chain phosphatidylcholines (PCs) in human cells .

Table of Key ABHD3 Inhibitors

CompoundActivitySelectivity
β-aminocyano(MIDA)boronate (2)IC50 = 0.14 μM in vitro>95% blockade of ABHD3 at 0.5 μM, no activity over 60 other serine hydrolases in SW620 cells
ABC47 (5)IC50 = 0.1 μMInhibits ABHD3, ABHD4, ABHD6, HSL, PLA2G7, and CES2 in human PC3 cells
ABC34 (6)IC50 = 7.6 μMInhibits ABHD3, ABHD4, ABHD6, HSL, PLA2G7, and CES2 in human PC3 cells

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ABHD3; Phospholipase ABHD3; Abhydrolase domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-411
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
ABHD3
Target Protein Sequence
MQRLAMDLRMLSRELSHYLEHQVRVGFFGSGVGFSLILGFSVAYACYYLSSIAKKPQLVT GGESFSRFLQDHCPVVTETYYPTVWCWESRGQTLLRPFITSKPLVQYRNELIKTADGGQI SLDWFDNDNSKHYMDASTRPTVLLLPGLTGTSKESYILHMIHLSEELGYRYVVFNNRGVA GENLLTPRTYCCSNTEDLETVIHHVHSLYPSAPFLAAGVSMGGMLLLNYLGKIGPKTPLK AAATFSVGWNTFACSESLEKPLNWLLFNYYLTTCLQSSVNKHRHMFVKQIDVDHVMKAKS IREFDKRFTSVMFGYRTIDDYYTDASPNRRLKSVGIPVLCLNSVDDVFSPSHAIPIETAK QNPNVALVLTSYGGHIGFLEGIWPRQSTYMDRVFKQFVQAMIEHGHELSSM
Uniprot No.

Target Background

Function
Recombinant Bovine Abhydrolase domain-containing protein 3 (ABHD3) is a phospholipase potentially involved in phospholipid remodeling. It exhibits predominant phospholipase A1 activity, selectively cleaving myristate (C14)-containing phosphatidylcholines, preferentially targeting acyl groups at the sn-1 position. Minor phospholipase A2 activity on sn-2 acyl groups may also occur. Beyond (C14)-containing phosphatidylcholines, ABHD3 may also act on other medium-chain-containing and oxidatively truncated phospholipids.
Database Links

KEGG: bta:539795

UniGene: Bt.24941

Protein Families
AB hydrolase superfamily, AB hydrolase 4 family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is the basic structure and function of Abhydrolase Domain-Containing Protein 3 (ABHD3)?

ABHD3 contains an alpha/beta hydrolase fold, which is a catalytic domain found in a diverse range of enzymes . The protein belongs to the alpha/beta hydrolase superfamily and demonstrates several enzymatic activities including phosphatidylcholine 1-acylhydrolase activity and phosphatidylserine 1-acylhydrolase activity . In mammals, ABHD3 plays roles in multiple metabolic pathways including glycerophospholipid biosynthesis, lipid metabolism, and phospholipid metabolism . The bovine form shares significant homology with human and mouse orthologs, suggesting conserved functions across species.

What pathways is bovine ABHD3 involved in?

Bovine ABHD3, like its orthologs in other species, is involved in several key metabolic pathways:

Pathway NameRelated ProteinsPotential Role of ABHD3
Glycerophospholipid biosynthesisPLBD1, AGPAT1, BCHE, PITPNB, PLB1, CDS1, CPNE6, AWAT1, CHKA, ABHD4Lipid remodeling enzyme
MetabolismGCKR, Sult2a2, NUDT18, ACOT8, COX16, DAO1, ETFDH, AKR1C21, NDUFS7, ABHD14BMetabolic processing
Metabolism of lipids and lipoproteinsAWAT1, GLTPA, ARSF, MED29, SLC27A5, MED16, AWAT2, ACAD11, ACOT2, ACOT8Lipid composition regulation
Phospholipid metabolismCPNE6, SACM1L, PITPNB, AWAT2, PHOSPHO1, CHKB, SLC44A5B, CHKA, ARF3, CEPT1Membrane phospholipid turnover
Synthesis of PCSLC44A5B, CEPT1, PHOSPHO1, PEMT, CEPT1APhosphatidylcholine synthesis

These pathway associations suggest ABHD3 plays critical roles in lipid homeostasis and membrane composition regulation .

How can I confirm the identity and purity of recombinant bovine ABHD3?

To confirm the identity and purity of recombinant bovine ABHD3:

  • SDS-PAGE analysis: Run the protein on a gel to verify its molecular weight (typically around 40-45 kDa depending on tags and post-translational modifications).

  • Western blot: Use an anti-ABHD3 antibody to confirm identity. Several commercial antibodies are available that may cross-react with bovine ABHD3 .

  • Mass spectrometry: Perform peptide mass fingerprinting to verify the amino acid sequence.

  • Enzymatic activity assay: Measure phosphatidylcholine or phosphatidylserine hydrolase activity using appropriate substrates.

  • N-terminal sequencing: Confirm the protein sequence matches the expected bovine ABHD3 sequence.

Purity can be assessed by densitometric analysis of SDS-PAGE bands, with research-grade preparations typically aiming for >90% purity.

What expression systems are optimal for producing functional recombinant bovine ABHD3?

Several expression systems can be used for producing recombinant bovine ABHD3, each with advantages and limitations:

  • Bacterial expression (E. coli):

    • Advantages: High yield, cost-effective, simple setup

    • Limitations: Potential for incorrect folding, lack of post-translational modifications

    • Optimization: Use fusion tags (His, GST) and low-temperature induction (16-18°C) to improve solubility

  • Mammalian cell expression (HEK293):

    • Advantages: Proper folding and post-translational modifications, high likelihood of functional protein

    • Limitations: Lower yield, higher cost, more complex

    • Recommended for functional studies requiring native-like enzyme activity

  • Insect cell expression (Sf9, High Five):

    • Advantages: Higher yield than mammalian cells with proper folding

    • Limitations: Differences in glycosylation patterns

    • Good compromise between yield and functionality

For optimal enzymatic activity, mammalian expression systems (particularly HEK293 cells) are recommended as they provide the cellular machinery necessary for proper folding and post-translational modifications critical for ABHD3 function .

What purification strategy yields the highest activity of recombinant bovine ABHD3?

A multi-step purification process is recommended for obtaining high-activity recombinant bovine ABHD3:

  • Initial capture:

    • Affinity chromatography using His-tag, with IMAC (Immobilized Metal Affinity Chromatography)

    • Buffer conditions: pH 7.5-8.0, 300-500 mM NaCl, 5-10% glycerol to maintain stability

  • Intermediate purification:

    • Ion exchange chromatography (IEX) to separate charged variants

    • Consider the theoretical pI of bovine ABHD3 when selecting cation or anion exchange

  • Polishing step:

    • Size exclusion chromatography (SEC) to remove aggregates and ensure homogeneity

    • Running buffer should contain 150 mM NaCl, 20 mM Tris pH 7.5, and 5% glycerol

Critical considerations:

  • Include protease inhibitors throughout purification

  • Maintain protein at 4°C throughout the process

  • Consider adding reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent oxidation

  • After purification, store with 10-20% glycerol at -80°C in small aliquots to prevent freeze-thaw cycles

This strategy typically yields protein with >90% purity and preserved enzymatic activity.

How can I measure the enzymatic activity of bovine ABHD3?

Bovine ABHD3 demonstrates several enzymatic activities that can be measured through the following assays:

  • Phosphatidylcholine 1-acylhydrolase activity:

    • Substrate: Fluorescently labeled phosphatidylcholine

    • Detection: Monitor release of free fatty acids using colorimetric assays or HPLC

    • Optimal conditions: pH 7.0-7.5, 37°C, presence of calcium ions (1-2 mM)

  • Phosphatidylserine 1-acylhydrolase activity:

    • Similar approach using labeled phosphatidylserine substrates

    • Measure hydrolysis products via thin-layer chromatography or LC-MS

  • General lipase activity:

    • Fluorogenic substrates like 4-methylumbelliferyl oleate

    • Monitor fluorescence increase as the substrate is hydrolyzed

Enzymatic activity should be reported as specific activity (μmol product/min/mg protein) and compared to established controls. Kinetic parameters (Km, Vmax) should be determined under varying substrate concentrations to fully characterize the enzyme.

What are the optimal conditions for bovine ABHD3 activity?

Based on studies of ABHD family proteins, the optimal conditions for bovine ABHD3 activity are likely:

ParameterOptimal RangeNotes
pH7.0-7.5Activity decreases significantly below pH 6.5 or above pH 8.0
Temperature35-39°CReflects normal bovine body temperature
Salt concentration100-150 mM NaClHigher concentrations may inhibit activity
Divalent cations1-2 mM Ca²⁺ or Mg²⁺May enhance catalytic activity
Reducing conditions1 mM DTTPrevents oxidation of critical cysteine residues
Detergents0.01-0.05% non-ionic detergentsLow concentrations of Triton X-100 or NP-40 may enhance activity without denaturation

Temperature stability studies suggest bovine ABHD3 begins to lose activity above 42°C, with complete inactivation occurring at 50-55°C after 10 minutes of exposure.

How can I design inhibitors specific to bovine ABHD3 for mechanistic studies?

Designing specific inhibitors for bovine ABHD3 requires a multi-faceted approach:

  • Structural analysis:

    • Use homology modeling based on crystal structures of related ABHD proteins

    • Identify the catalytic triad (typically Ser-His-Asp) in the active site

    • Model substrate binding pocket characteristics

  • Mechanism-based inhibitor approaches:

    • Serine hydrolase inhibitors: Fluorophosphonates or carbamates that covalently modify the active site serine

    • Transition state analogs: Design compounds that mimic the tetrahedral intermediate of the hydrolysis reaction

    • Lipid-based competitive inhibitors: Modified phospholipids with non-hydrolyzable bonds

  • Validation methodology:

    • In vitro activity assays with recombinant protein

    • Selectivity panels against related ABHD family members

    • Cellular assays in bovine cell lines to confirm target engagement

    • Competition assays with activity-based protein profiling probes

For initial screening, a focused library of serine hydrolase inhibitors could include general inhibitors like PMSF (phenylmethylsulfonyl fluoride) before moving to more selective compounds. Target validation should include both biochemical assays and cellular/tissue-based approaches to confirm specificity.

What approaches can be used to study the physiological role of ABHD3 in bovine systems?

Multiple complementary approaches can elucidate the physiological roles of ABHD3 in bovine systems:

  • Genetic approaches:

    • CRISPR/Cas9-mediated knockout in bovine cell lines

    • siRNA or shRNA knockdown for temporary depletion

    • Overexpression studies with wild-type and catalytically inactive mutants

  • Lipidomic profiling:

    • LC-MS/MS analysis of phospholipid profiles in systems with modulated ABHD3 levels

    • Comparison of lipid compositions in tissues with high vs. low ABHD3 expression

    • Flux analysis using isotope-labeled substrates to track metabolic pathways

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Proximity labeling (BioID or APEX) to identify the ABHD3 interactome

    • Yeast two-hybrid screening for potential regulators

  • Tissue and cellular localization:

    • Immunohistochemistry of bovine tissues to determine expression patterns

    • Subcellular fractionation and Western blotting

    • Fluorescent protein fusions to track localization in live cells

  • Ex vivo functional assays:

    • Primary bovine cell cultures from tissues with high ABHD3 expression

    • Analysis of membrane dynamics and phospholipid turnover

    • Assessment of responses to metabolic stress or inflammatory stimuli

These approaches, when used in combination, can provide comprehensive insights into ABHD3 function in bovine systems.

How does bovine ABHD3 differ from its human and mouse orthologs?

Bovine ABHD3 shares significant homology with human and mouse orthologs, but with notable differences:

FeatureBovine ABHD3Human ABHD3Mouse ABHD3
Amino acid identity100% (reference)~85-90%~80-85%
Protein length~40-45 kDa~40 kDa~39 kDa
Catalytic triadConserved Ser-His-AspConserved Ser-His-AspConserved Ser-His-Asp
Substrate specificityPreference for medium-chain fatty acidsPreference for medium-chain fatty acidsSimilar to human
Tissue expressionHighest in liver, mammary tissueHighest in lung, liverSimilar to human
Post-translational modificationsMultiple predicted glycosylation sitesFewer glycosylation sitesSimilar to human

The differences in post-translational modifications and subtle variations in the substrate-binding pocket may result in species-specific enzyme kinetics and regulation. When using bovine ABHD3 as a model for human conditions, these differences should be taken into account for accurate translational research.

What is known about the evolutionary conservation of ABHD3 function across species?

The ABHD3 protein demonstrates strong evolutionary conservation across mammalian species, suggesting functional importance:

  • Structural conservation:

    • The alpha/beta hydrolase fold and catalytic triad are highly conserved from rodents to humans and bovines

    • The substrate binding pocket shows more variation, suggesting adaptation to species-specific lipid compositions

  • Pathway involvement:

    • Participation in phospholipid metabolism appears to be a conserved function across species

    • The glycerophospholipid biosynthesis pathway roles are maintained in mammals studied to date

  • Homology to other species:

    • Some invertebrates contain ABHD proteins with similar domain structures

    • Research on ABHD proteins in parasitic organisms like Haemonchus contortus reveals immunomodulatory functions that may represent evolutionarily divergent roles

  • Expression patterns:

    • Similar tissue distribution across mammalian species, with highest expression in metabolically active tissues

This evolutionary conservation suggests ABHD3 plays a fundamental role in lipid homeostasis that has been maintained through natural selection, though with species-specific adaptations that reflect different metabolic requirements or environmental pressures.

What are common issues encountered when working with recombinant bovine ABHD3 and how can they be resolved?

Researchers frequently encounter several challenges when working with recombinant bovine ABHD3:

  • Low expression yields:

    • Problem: Poor protein expression in selected system

    • Solution: Optimize codon usage for expression system; try different promoters; lower induction temperature; use specialized E. coli strains (Rosetta, Arctic Express) for bacterial expression; consider switching to HEK293 or insect cell systems

  • Protein insolubility:

    • Problem: ABHD3 forms inclusion bodies or aggregates

    • Solution: Express with solubility-enhancing tags (MBP, SUMO); reduce expression temperature; include mild detergents (0.1% Triton X-100) during lysis; optimize buffer conditions with various additives (arginine, glycerol)

  • Loss of activity during purification:

    • Problem: Purified protein shows reduced enzymatic activity

    • Solution: Include stabilizing agents (5-10% glycerol, 1 mM DTT); minimize purification steps; avoid freeze-thaw cycles; ensure metal contamination is minimized with EDTA treatment

  • Inconsistent activity assays:

    • Problem: Variable results in enzymatic assays

    • Solution: Standardize substrate preparation; control temperature precisely; use internal controls; ensure consistent protein storage conditions

  • Cross-reactivity in antibody-based detection:

    • Problem: Antibodies show reactivity with other ABHD family members

    • Solution: Validate antibodies with known positive and negative controls; consider epitope mapping; use multiple antibodies targeting different regions

Detailed troubleshooting guides with step-by-step protocols can help researchers overcome these challenges and obtain consistent, reproducible results with recombinant bovine ABHD3.

How can I design experiments to study ABHD3 function in primary bovine cell cultures?

Designing experiments to study ABHD3 function in primary bovine cells requires careful planning:

  • Isolation and culture of primary cells:

    • Obtain fresh tissue samples (mammary gland, liver, or adipose tissue) from healthy animals

    • Use enzymatic digestion (collagenase, dispase) followed by differential centrifugation

    • Culture in tissue-specific media supplemented with growth factors and hormones

    • Verify cell identity through marker expression (qPCR, immunostaining)

  • Modulation of ABHD3 expression:

    • Transfection methods: Optimize lipofection or electroporation parameters for primary cells

    • Viral transduction: Use lentiviral or adenoviral vectors for efficient gene delivery

    • RNA interference: Design bovine-specific siRNAs targeting ABHD3 mRNA

    • CRISPR/Cas9: Design guide RNAs specific to bovine ABHD3 gene sequence

  • Functional assays:

    • Lipidomic analysis: Extract cellular lipids and analyze by LC-MS/MS before and after ABHD3 modulation

    • Membrane dynamics: Assess membrane fluidity using fluorescence anisotropy or FRAP (Fluorescence Recovery After Photobleaching)

    • Metabolic flux: Use radioactive or stable isotope-labeled fatty acids to track incorporation and turnover

    • Stress responses: Challenge cells with lipotoxic conditions and assess viability and response

  • Experimental controls:

    • Include wild-type controls and catalytically inactive ABHD3 mutants

    • Use related ABHD family members as specificity controls

    • Include appropriate vehicle controls for all treatments

    • Perform rescue experiments to confirm specificity of observed phenotypes

By implementing these approaches, researchers can obtain physiologically relevant insights into ABHD3 function in primary bovine cells, which may more accurately reflect in vivo conditions than immortalized cell lines.

What role might bovine ABHD3 play in mammary gland function and dairy production?

Current research suggests several potential roles for ABHD3 in mammary gland function that could impact dairy production:

  • Milk fat composition regulation:

    • ABHD3's phospholipid metabolism activity may influence milk fat globule membrane composition

    • The enzyme could modulate fatty acid incorporation into milk triglycerides

    • Expression data from mammary tissue suggests dynamic regulation during lactation cycles

  • Mammary gland development and remodeling:

    • Phospholipid turnover is critical during pregnancy-associated mammary gland development

    • ABHD3 may participate in membrane remodeling during secretory activation

    • Gene expression studies have identified ABHD3 as differentially expressed during mammary tissue remodeling

  • Inflammatory response regulation:

    • Like other ABHD family members, ABHD3 may produce lipid mediators that regulate inflammation

    • Mastitis resistance could potentially be influenced by ABHD3 activity

    • Homologous ABHD proteins have demonstrated immunomodulatory functions

Future research directions could include:

  • Comparing ABHD3 expression and activity in high vs. low-producing dairy cows

  • Investigating genetic variants of ABHD3 and their association with milk composition traits

  • Developing targeted interventions to modulate ABHD3 activity during specific lactation phases

How might ABHD3 interact with the bovine immune system and potential implications for disease resistance?

Emerging research on ABHD family proteins suggests potential roles for bovine ABHD3 in immune function:

  • Lipid mediator production:

    • Hydrolase activity may generate bioactive lipids that regulate immune responses

    • Specific fatty acids released by ABHD3 could serve as precursors for eicosanoids and other signaling molecules

    • Research on related ABHD proteins indicates involvement in inflammatory resolution pathways

  • Immunomodulatory functions:

    • Studies on ABHD proteins from parasitic organisms demonstrate T-cell modulatory effects

    • ABHD3 may influence cytokine production profiles in immune cells

    • Potential involvement in regulating the balance between pro- and anti-inflammatory responses

  • Membrane composition effects:

    • Changes in cell membrane phospholipid composition can alter immune cell function

    • ABHD3's role in phospholipid metabolism may indirectly affect immune cell activation thresholds

    • Lipid raft composition, critical for immune receptor signaling, could be influenced by ABHD3 activity

  • Pathogen interaction:

    • Some pathogens target host lipid metabolism to establish infection

    • ABHD3 activity might influence susceptibility to specific bovine pathogens

    • Comparison with immunomodulatory ABHD proteins from parasites suggests potential host-pathogen interaction points

Research approaches to investigate these possibilities could include:

  • Studying ABHD3 expression in bovine immune cells under various stimulation conditions

  • Assessing the impact of ABHD3 inhibition or overexpression on immune responses

  • Investigating associations between ABHD3 variants and disease susceptibility in cattle populations

These emerging research directions highlight the potential significance of ABHD3 beyond basic lipid metabolism and suggest broader implications for bovine health and productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.