Recombinant Bovine Acetylcholine receptor subunit epsilon (CHRNE)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

Recombinant bovine CHRNE is synthesized using heterologous expression systems:

  • Expression: Optimized in E. coli for high yield, leveraging bacterial machinery for rapid protein synthesis .

  • Purification: Affinity chromatography via His-tag ensures >90% purity (SDS-PAGE verified) .

  • Storage: Lyophilized powder in Tris/PBS buffer with trehalose stabilizers, stable at -80°C .

Key Challenges:

  • Retaining functional conformation in bacterial systems due to the absence of mammalian glycosylation pathways .

  • Solubility issues with transmembrane domains, requiring detergent-based extraction .

Disease Modeling

  • Congenital Myasthenic Syndromes (CMS): Used to study ε-subunit mutations (e.g., frameshift variants like c.632_633dupCG) that reduce AChR density at neuromuscular junctions .

  • Autoimmune Disorders: Serves as an antigen in assays for myasthenia gravis autoantibody detection .

Drug Development

  • Screens for small molecules modulating nAChR activity (e.g., pyridostigmine) to treat CMS .

Evolutionary Studies

  • Ancestral β-subunit reconstructions reveal homopentameric channel functionality, highlighting evolutionary divergence in nAChR architecture .

Comparative Analysis with Human CHRNE

FeatureBovine CHRNEHuman CHRNE
Amino Acid Identity~85%100%
CMS-Linked MutationsLimited data>90 mutations identified (e.g., εR64X)
Expression SystemsPrimarily E. coli E. coli, HEK cells

Research Limitations and Future Directions

  • Functional Assays: Lack of native lipid membrane context in E. coli-produced CHRNE may skew ion channel kinetics .

  • Structural Biology: Cryo-EM studies of full-length bovine nAChR complexes are needed to resolve activation mechanisms.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them in your order. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHRNE; Acetylcholine receptor subunit epsilon
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-491
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
CHRNE
Target Protein Sequence
KNEELRLYHYLFDTYDPGRRPVQEPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDW QDYRLNYSKGDFGGVETLRVPSELVWLPEIVLENNIDGQFGVAYEANVLVSEGGYLSWLP PAIYRSTCAVEVTYFPFDWQNCSLVFRSQTYNAEEVEFVFAVDDEGKTISKIDIDTEAYT ENGEWAIDFCPGVIRRHDGDSAGGPGETDVIYSLIIRRKPLFYVINIIVPCVLISGLVLL AYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKTPETSLSVPLLGRYLIFVMVVATLIVM NCVIVLNVSLRTPTTHAMSPRLRYVLLELLPQLLGSGAPPEIPRAASPPRRASSLGLLLR AEELILKKPRSELVFEQQRHRHGTWTATLCQNLGAAAPEIRCCVDAVNFVASSTRDQEAT GEEVSDWVRMGKALDSICFWAALVLFLVGSSLIFLGAYFNRVPQLPYPPCM
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change that affects all subunits and leads to the opening of an ion-conducting channel across the plasma membrane.
Gene References Into Functions
  1. To identify the genetic defect in four previously reported Brahman calves with severe myasthenic weakness, the genomic structure of the gene encoding the bovine epsilon-subunit (bovCHRNE) of the acetylcholine receptor (AChR) was determined. PMID: 12481987
  2. Mutations within muscle AChRs are the most common cause of Congenital Myasthenic Syndrome (CMS). Most mutations are located within the epsilon-subunit gene and result in AChR deficiency. PMID: 14592869
  3. Genotyping of the South African, registered, Brahman cattle population for the 470del20 mutation in the CHRNE gene causing congenital myasthenic syndrome is reported. PMID: 17121978
Database Links

KEGG: bta:281688

STRING: 9913.ENSBTAP00000042804

UniGene: Bt.4231

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Epsilon/CHRNE sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of the acetylcholine receptor epsilon subunit?

The acetylcholine receptor subunit epsilon (CHRNE) is a critical component of the adult muscle-type nicotinic acetylcholine receptor (AChR). The recombinant full-length bovine CHRNE protein (P02715) spans amino acids 21-491 and contains key functional domains that contribute to receptor assembly and ion channel formation .

AChRs in adult muscle typically form as heteropentameric structures composed of two α subunits along with β, δ, and ε subunits, arranged in a specific conformation around a central ion channel. The epsilon subunit replaces the gamma subunit during development, transitioning from embryonic (α2βδγ) to adult (α2βδε) forms .

Methodologically, structural studies of CHRNE often employ techniques such as:

  • X-ray crystallography

  • Cryo-electron microscopy

  • Single-channel electrophysiology to analyze channel properties

  • Computational modeling based on homologous proteins

  • How are CHRNE mutations linked to congenital myasthenic syndromes?

Mutations in the CHRNE gene are the most common cause of congenital myasthenic syndromes (CMS), estimated to be responsible for up to 50% of all CMS cases . These disorders represent a heterogeneous group of inherited neuromuscular transmission defects .

CHRNE mutations typically fall into two major categories:

  • Kinetic mutations: Affecting channel gating properties with minimal effect on AChR expression

    • Slow-channel syndromes: Characterized by abnormally slow decay of synaptic currents due to prolonged AChR channel opening

    • Fast-channel syndromes: Featuring abnormally fast decay of synaptic response due to brief channel opening events, decreased acetylcholine affinity, or impaired gating efficiency

  • Low-expressor mutations: Leading to primary AChR deficiency with reduced surface expression

Research methodologies typically include:

  • Genetic testing (exome sequencing, targeted gene panels)

  • Electrophysiological studies comparing wild-type and mutant receptors

  • Muscle biopsies to quantify AChR levels

  • Family segregation analysis to determine inheritance patterns

  • What experimental systems are used to express recombinant CHRNE proteins?

Multiple expression systems have been developed to produce and study recombinant CHRNE proteins:

Expression SystemAdvantagesApplicationsReference
E. coliHigh yield, cost-effective, N-terminal His-tagged purificationProtein structure studies, antibody production
COS cellsMammalian post-translational modifications, surface expressionReceptor assembly studies, heteropentamer formation
Xenopus oocytesFunctional expression, electrophysiological recordingsChannel function analysis
Cultured myotubesNative cellular environment, physiological assemblyTurnover studies, clustering analysis

For functional studies, researchers typically transfect cells with cDNAs encoding multiple AChR subunits (α, β, δ, ε) to reconstitute the pentameric receptor. Species-specific differences in expression efficiency have been noted, with mouse epsilon subunit cDNA approximately 10 times more effective than rat in supporting surface AChR expression .

  • What techniques are used to measure acetylcholine receptor turnover and degradation?

Acetylcholine receptor turnover can be precisely measured using radioligand-based approaches:

Methodology:

  • Surface labeling: Incubate cells expressing AChRs with 125I-α-bungarotoxin (α-BuTx, 220 Ci/mmol) for 90 minutes at 37°C

  • Control for non-specific binding: Include parallel samples with excess unlabeled α-BuTx (1 μM) or use sham-transfected cells

  • Wash step: Remove unbound 125I-α-BuTx by washing cells three times with PBS

  • Solubilization: Dissolve cells in 0.1N NaOH

  • Quantification: Count radioactivity using a gamma counter

For degradation rate determination:

  • Label surface receptors with 125I-α-bungarotoxin

  • Measure the subsequent appearance of radioactivity in the medium over time

  • Calculate half-life by plotting the logarithm of surface radioactivity remaining versus time

Using this approach, researchers have determined that adult AChRs have a half-life of approximately 11 hours in the absence of rapsyn, which increases to 17 hours when rapsyn is present .

  • How are CHRNE gene variants analyzed in clinical research?

Analysis of CHRNE variants follows a systematic approach combining multiple techniques:

Standard workflow for CHRNE variant analysis:

  • DNA extraction from patient blood samples

  • Next-generation sequencing (NGS) using custom-designed capture probes targeting the CHRNE gene

  • Bioinformatic analysis with coverage typically exceeding 100× for accurate variant detection

  • Variant filtration based on population frequency databases

  • Confirmation of variants by Sanger sequencing

  • Family segregation studies to determine inheritance patterns

  • In silico prediction tools to assess potential pathogenicity

For copy number variations:

  • PCR-based quantitative methods detect deletions and duplications

  • Sequencing coverage analysis identifies large genomic rearrangements

Test sensitivity for CHRNE sequencing typically exceeds 99% for single nucleotide variants and is above 94% for insertions and deletions less than 40 base pairs .

Advanced Research Questions

  • How do species differences in epsilon subunits affect receptor assembly and function?

Species variations in CHRNE sequences provide valuable insights into critical regions for AChR assembly:

Experimental approach for identifying assembly-critical regions:

  • Transfection experiments: COS cells were transfected with alpha subunits plus either mouse or rat epsilon subunit cDNAs

  • Quantification of surface expression: Mouse epsilon subunit demonstrated approximately 10-fold higher efficiency than rat in supporting AChR surface expression

  • Assembly intermediate analysis: Formation of alpha-epsilon heterodimers (assembly intermediates) was less efficient with rat than mouse epsilon subunits

  • Site-directed mutagenesis: Systematic mutation identified two critical amino acid positions (106 and 115) in the N-terminal domain responsible for these differences

These findings highlight how subtle species differences (just two amino acids in this case) can dramatically impact receptor assembly efficiency. The techniques demonstrate how evolutionary comparisons can reveal functionally critical protein regions without requiring complete crystal structures.

  • What are the pharmacological approaches for treating CHRNE-related congenital myasthenic syndromes?

A meta-analysis of pharmacological treatment strategies for CMS patients with CHRNE mutations revealed several important findings:

Treatment strategies analyzed:

  • Acetylcholinesterase inhibitors (AChEIs)

  • 3,4-diaminopyridine (DAP)

  • β2-adrenergic receptor agonists (BA)

  • Fluoxetine (FLX)

  • Quinidine (QUIN)

  • Various combination therapies

Key findings from meta-analysis:

  • β2-adrenergic receptor agonists demonstrated the best treatment effect for CMS patients with CHRNE mutations

  • Single-drug regimens were more effective than combination therapies

  • Treatment effectiveness was not influenced by age at disease onset

  • Different mutation types (primary AChR deficiency, slow-channel, fast-channel) respond differently to treatments

The methodology involved systematic review of 48 studies including 208 CMS patients with CHRNE mutations, categorizing treatment effects as: (-) no effect; (+) partial/incomplete; (++) beneficial/clear; or (+++) remarkable/dramatic .

  • How can ancestral reconstruction techniques inform our understanding of AChR subunit evolution and function?

Ancestral reconstruction of AChR subunits has revealed unexpected properties with significant implications for receptor function:

Experimental approach:

  • Phylogenetic analysis: Reconstructing ancestral β-subunit (βAnc) sequences based on evolutionary relationships

  • Expression studies: Expressing reconstructed sequences in heterologous systems

  • Electrophysiological characterization: Patch-clamp recordings of channel properties

Key findings:

  • Reconstructed ancestral β-subunits can form functional homopentameric channels, unlike modern β-subunits

  • These homopentamers open spontaneously without requiring acetylcholine binding

  • Channel properties exhibit hallmarks of muscle-type AChRs, including characteristic burst behavior

  • The findings demonstrate that fundamental aspects of AChR activation are independent of agonist and not solely determined by heteropentameric structure

This approach combines evolutionary biology with electrophysiology to provide insights into channel function that would be difficult to obtain through conventional mutagenesis studies.

  • What kinetic properties characterize channels containing recombinant CHRNE, and how are they measured?

Single-channel electrophysiology reveals detailed kinetic properties of AChR channels containing CHRNE:

Methodological approach:

  • Cell-attached patch-clamp recordings at -120 mV holding potential

  • Signal filtering at 10 kHz for high temporal resolution

  • Acetylcholine concentration series (typically 3-100 μM)

  • Open and closed duration histograms constructed for each concentration

  • Global kinetic modeling to fit the entire dataset to mechanistic models

Key observations:

  • As acetylcholine concentration increases from 10 to 100 μM, duration of openings progressively decreases

  • Reciprocal increase in short-lived closings within each burst occurs at higher concentrations

  • This manifests as a leftward shift in open duration histograms with increasing concentration

  • These patterns represent open-channel block, a hallmark of AChR agonist interaction

Similar experiments with open-channel blockers like QX-222 provide additional insights into pore structure and function through analysis of blocking and unblocking rates.

  • How does rapsyn interaction affect CHRNE metabolic stability and what are the implications for receptor regulation?

Rapsyn, a 43 kDa peripheral membrane protein associated with AChRs at the neuromuscular junction, significantly impacts receptor turnover:

Experimental design:

  • Expression systems:

    • Transfected COS cells with adult (α2βδε) or embryonic (α2βδγ) AChRs

    • Cultured myotubes from rapsyn-positive and rapsyn-negative mice

  • Receptor turnover measurement:

    • 125I-α-bungarotoxin labeling of surface receptors

    • Monitoring radioactivity release to measure degradation rates

  • Dose-response analysis:

    • Varying amounts of rapsyn cDNA (1-4 μg per 60 mm dish)

    • Measuring resulting receptor half-lives

Key findings:

  • Rapsyn increases AChR half-life by up to twofold

  • For adult AChRs, half-life increases from 11h to 17h with 1 μg rapsyn cDNA

  • Half-life increases further to 28h with 4 μg rapsyn cDNA

  • Effect occurs with both embryonic and adult receptor forms

  • The effect was monotonically dependent on rapsyn expression level

These findings suggest a mechanism for regulating receptor density at the neuromuscular junction through modulation of turnover rates rather than just synthesis rates.

  • What is the significance of N-box mutations in the CHRNE promoter for gene expression and disease?

N-box mutations in the CHRNE promoter represent an important class of regulatory mutations affecting AChR expression:

Research findings:

  • Clinical observation: A consanguineous family with two siblings showing clinical and electromyographic features of AChR deficiency

  • Genetic analysis: Both affected individuals carried a homozygous single point mutation - a C→T transition in the N-box of the epsilon-subunit promoter

  • Expression analysis: Intercostal biopsy showed dramatic reduction in epsilon-subunit mRNA levels compared to controls

  • Functional significance: First evidence in humans that N-box mutations can disrupt epsilon-subunit transcription

The N-box sequence is critical for synapse-specific expression of AChR subunits. This case demonstrated that regulatory mutations can cause the clinical phenotype of AChR-deficiency congenital myasthenic syndrome without any changes to the coding sequence, highlighting the importance of analyzing promoter regions in genetic studies of CMS patients.

  • How can electrical fingerprinting techniques using modified CHRNE constructs advance our understanding of receptor stoichiometry?

Electrical fingerprinting using conductance-altered CHRNE subunits provides powerful tools for studying receptor composition:

Methodological approach:

  • Creation of conductance variants:

    • High conductance (HC) wild-type channels (~16 pA)

    • Low conductance (LC) variants created by introducing charged residues at cytoplasmic portals

  • Engineering specific mutations: Substitution of three arginine residues (E420R, D424R, and E428R) in the cytoplasmic domain

  • Single-channel recording: Patch-clamp electrophysiology to measure current amplitudes

  • Conductance analysis: Channels with modified subunits show reduced conductance (~1-2 pA)

This approach allows researchers to determine:

  • Subunit stoichiometry in functional channels

  • Assembly patterns in mixed subunit populations

  • Contributions of specific subunits to channel properties

The technique exploits the fact that ion conduction is influenced by charged residues at cytoplasmic portals, providing a "fingerprint" for different subunit compositions without altering other channel properties.

  • What experimental design considerations are critical when studying CHRNE function in heterologous systems?

When designing experiments to study CHRNE function in heterologous expression systems, several critical factors must be considered:

Key experimental design considerations:

  • Subunit ratios: Maintain consistent cDNA ratios (typically 2:1:1:1 for α:β:δ:ε) to ensure proper stoichiometry

  • DNA quantity: Total cDNA amount affects expression levels and potentially subunit assembly patterns

  • Expression time: Allowing sufficient time (typically 48-72 hours) for protein expression and assembly

  • Temperature: Expression at lower temperature (30-33°C) can improve folding of complex proteins

  • Controls for subunit omission: Express incomplete combinations to verify specific subunit requirements

  • Species compatibility: Consider whether subunits from different species can co-assemble efficiently

Unexpected findings often emerge from variations in experimental protocols. For example, reducing total cDNA amount sixfold while maintaining subunit ratios led to the discovery of homopentameric channels formed by ancestral β-subunits, revealing previously unknown functional capabilities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.